Welcome! Click here to login or here to register.
Home
Pathways
Proteins
Catalytic RNA molecules
Enzymatic complexes
Structures
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

La protein homolog

 
Known also as: La autoantigen homolog, La ribonucleoprotein

Known abbreviations: LHP1, LAH1, YLA1, YDL051W

 

FUNCTION:
 
Molecular chaperone that binds nascent RNA polymerase III transcripts, stabilizing these RNAs against exonucleases. Required for the 3' endonucleolytic cleavage that matures tRNA precursors and for efficient folding of certain pre-tRNAs. Cooperaes with GCD14 in the maturation of a subset of RNA polymerase III transcripts. Functions also in the assembly of certain RNA polymerase II-transcribed RNAs into RNPs. Binds and stabilizes newly synthesized U6 snRNA as well as precursors of U3 snRNA from degradation. Facilitates efficient Sm protein binding, thus assisting formation of the U4/U6 snRNP. Required fot Ty3 normal transposition frequency. 
 
SUBUNIT STRUCTURE:
 
Interacts with SXM1. 
 
CELLULAR LOCALIZATION:
 
Nucleus. Note: Imported into nucleus by the nuclear transport factor SXM1. 
 
POST-TRANSLATIONAL MODIFICATION:
 
Phosphorylation is not required for the roles tRNA and snRNP biogenesis.



Activities in which La protein homolog is involved: Pathways in which La protein homolog is involved:

NCBI GI number(s): 6320152
296143313
Species: Saccharomyces cerevisiae

Links to other databases:

Database ID Link
Uniprot P33399 P33399
BRENDA - -
KEGG sce:YDL051W sce:YDL051W
PFAM: PF05383
PF00076
PF05383
PF00076
InterPro: IPR002344
IPR006630
IPR012677
IPR000504
IPR011991
IPR002344
IPR006630
IPR012677
IPR000504
IPR011991
CATH: - -
SCOP: - -


Protein sequence:
MSEKPQQEEQEKPQSRRNSFAVIEFTPEVLDRCLKQVEFYFSEFNFPYDR
FLRTTAEKNDGWVPISTIATFNRMKKYRPVDKVIEALRSSEILEVSADGE
NVKRRVPLDLTAARNARIEQNQRTLAVMNFPHEDVEASQIPELQENLEAF
FKKLGEINQVRLRRDHRNKKFNGTVLVEFKTIPECEAFLKSYSNDDESNE
ILSYEGKKLSVLTKKQFDLQREASKSKNFSGRSRSFNGHKKKNLPKFPKN
KKKNGKEESKEDSSAIADDDEEHKE

La protein homolog (Saccharomyces cerevisiae) is product of expression of LPH1 gene.



Add your own comment!


There are no comments yet.

Last modification of this entry: Sept. 25, 2012.

Welcome stranger! Click here to login or here to register.