Welcome! Click here to login or here to register.
Home
Pathways
Proteins
Catalytic RNA molecules
Enzymatic complexes
Structures
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

Superkiller protein 7

 
Known abbreviations: SKI7, YOR076C, YOR29-27

 

 
FUNCTION:
 
Represses the expression of non-poly(A) mRNAs like L-A or M viruses and is therefore involved in antiviral system. Mediates interactions via its N-terminus between the exosome and the SKI complex which operate in the 3'-to-5' mRNA-decay pathway. By interacting with NAM7, is also required for nonsense-mediated 3'-to-5' mRNA-decay (NMD). May recognize a stalled 80S ribosome at the 3'-end of a nonstop mRNA which leads to the recruitment of the exosome and SKI complexes to the mRNAs to be degraded. 
 
SUBUNIT STRUCTURE:
 
Interacts with the exosome and with the SKI complex composed of at least SKI2, SKI3 and SKI8. Interacts directly with SKI3 and SKI8. 
 
CELLULAR LOCALIZATION:
 
Cytoplasm.
 
DOMAIN:
 
The N-terminal domain (residues 1 to 264) is required and sufficient for interaction with the exosome and SKI complexes and for 3'-to-5' mRNA degradation.

 




Activities in which Superkiller protein 7 is involved: Pathways in which Superkiller protein 7 is involved:

NCBI GI number(s): 6324650
296148077
Species: Saccharomyces cerevisiae

Links to other databases:

Database ID Link
Uniprot Q08491 Q08491
BRENDA sce:YOR076C sce:YOR076C
KEGG - -
PFAM: PF00009
PF00009
InterPro: IPR000795
IPR000795
CATH: - -
SCOP: - -


Protein sequence:
MSLLEQLARKRIEKSKGLLSADQSHSTSKSASLLERLHKNRETKDNNAET
KRKDLKTLLAKDKVKRSDFTPNQHSVSLSLKLSALKKSNSDLEKQGKSVT
LDSKENELPTKRKSPDDKLNLEESWKAIKEMNHYCFLKNDPCINQTDDFA
FTNFIIKDKKNSLSTSIPLSSQNSSFLSLKKHNNELLGIFVPCNLPKTTR
KVAIENFNRPSPDDIIQSAQLNAFNEKLENLNIKSVPKAEKKEPINLQTP
PTESIDIHSFIATHPLNLTCLFLGDTNAGKSTLLGHLLYDLNEISMSSMR
ELQKKSSNLDPSSSNSFKVILDNTKTERENGFSMFKKVIQVENDLLPPSS
TLTLIDTPGSIKYFNKETLNSILTFDPEVYVLVIDCNYDSWEKSLDGPNN
QIYEILKVISYLNKNSACKKHLIILLNKADLISWDKHRLEMIQSELNYVL
KENFQWTDAEFQFIPCSGLLGSNLNKTENITKSKYKSEFDSINYVPEWYE
GPTFFSQLYLLVEHNMNKIETTLEEPFVGTILQSSVLQPIAEINYVSLKV
LINSGYIQSGQTIEIHTQYEDFHYYGIVSRMKNSKQILETNTKNNISVGL
NPDILEVLVKIHNTEDFTKKQFHIRKGDIIIHSRKTNTLSPNLPNTLKLL
ALRLIKLSIQTHALSDPVDLGSELLLYHNLTHNAVKLVKILGTNDISINP
NQSLIVEVEIIEPDFALNVIDSKYITNNIVLTSIDHKVIAVGRIACQ

Superkiller protein 7 (Saccharomyces cerevisiae) is product of expression of Ski7 gene.

References:

Title Authors Journal Publication date (Issue) PubMed ID
Interaction between Ski7p and Upf1p is required for nonsense-mediated 3'-to-5' mRNA decay in yeast. Takahashi S, Araki Y, Sakuno T, Katada T EMBO J 2003-08-01 (22) 12881429
The nucleotide sequence of Saccharomyces cerevisiae chromosome XV. Dujon B, Albermann K, Aldea M, Alexandraki D, Ansorge W, Arino J, Benes V, Bohn C, Bolotin-Fukuhara M, Bordonne R, Boyer J, Camasses A, Casamayor A, Casas C, Cheret G, Cziepluch C, Daignan-Fornier B, Dang DV, de Haan M, Delius H, Durand P, Fairhead C, Feldmann H, Gaillon L, Kleine K, et al. Nature 1997-05-01 (387) 9169874
A single subunit, Dis3, is essentially responsible for yeast exosome core activity. Dziembowski A, Lorentzen E, Conti E, Seraphin B Nat Struct Mol Biol 2007-02-01 (14) 17173052
Global analysis of protein expression in yeast. Ghaemmaghami S, Huh WK, Bower K, Howson RW, Belle A, Dephoure N, O'Shea EK, Weissman JS Nature 2003-10-16 (425) 14562106
A multidimensional chromatography technology for in-depth phosphoproteome analysis. Albuquerque CP, Smolka MB, Payne SH, Bafna V, Eng J, Zhou H Mol Cell Proteomics 2008-07-01 (7) 18407956
Systematic, genome-wide identification of host genes affecting replication of a positive-strand RNA virus. Kushner DB, Lindenbach BD, Grdzelishvili VZ, Noueiry AO, Paul SM, Ahlquist P Proc Natl Acad Sci U S A 2003-12-23 (100) 14671320
The sequence of a 54.7 kb fragment of yeast chromosome XV reveals the presence of two tRNAs and 24 new open reading frames. Valens M, Bohn C, Daignan-Fornier B, Dang VD, Bolotin-Fukuhara M Yeast 1997-03-01 (13) 9133743
Decapping and decay of messenger RNA occur in cytoplasmic processing bodies. Sheth U, Parker R Science 2003-05-02 (300) 12730603
Analysis of phosphorylation sites on proteins from Saccharomyces cerevisiae by electron transfer dissociation (ETD) mass spectrometry. Chi A, Huttenhower C, Geer LY, Coon JJ, Syka JE, Bai DL, Shabanowitz J, Burke DJ, Troyanskaya OG, Hunt DF Proc Natl Acad Sci U S A 2007-01-13 (104) 17287358
Superkiller mutations in Saccharomyces cerevisiae suppress exclusion of M2 double-stranded RNA by L-A-HN and confer cold sensitivity in the presence of M and L-A-HN. Ridley SP, Sommer SS, Wickner RB... Mol Cell Biol 1984-04-01 (4) 6371496
The ski7 antiviral protein is an EF1-alpha homolog that blocks expression of non-Poly(A) mRNA in Saccharomyces cerevisiae. Benard L, Carroll K, Valle RC, Masison DC, Wickner RB... J Virol 1999-04-01 (73) 10074137
Function of the ski4p (Csl4p) and Ski7p proteins in 3'-to-5' degradation of mRNA. van Hoof A, Staples RR, Baker RE, Parker R... Mol Cell Biol 2000-11-01 (20) 11027292
Ski7p G protein interacts with the exosome and the Ski complex for 3'-to-5' mRNA decay in yeast. Araki Y, Takahashi S, Kobayashi T, Kajiho H, Hoshino S, Katada T... EMBO J 2001-09-03 (20) 11532933
The yeast cytoplasmic LsmI/Pat1p complex protects mRNA 3' termini from partial degradation. He W, Parker R... Genetics 2001-08-01 (158) 11514438
Exosome-mediated recognition and degradation of mRNAs lacking a termination codon. van Hoof A, Frischmeyer PA, Dietz HC, Parker R... Science 2002-03-22 (295) 11910110
An NMD pathway in yeast involving accelerated deadenylation and exosome-mediated 3'-->5' degradation. Mitchell P, Tollervey D... Mol Cell 2003-05-01 (11) 12769863
Translation of aberrant mRNAs lacking a termination codon or with a shortened 3'-UTR is repressed after initiation in yeast. Inada T, Aiba H... EMBO J 2005-04-20 (24) 15933721
Domain interactions within the Ski2/3/8 complex and between the Ski complex and Ski7p. Wang L, Lewis MS, Johnson AW... RNA 2005-08-01 (11) 16043509



Add your own comment!


There are no comments yet.

Last modification of this entry: Sept. 25, 2012.

Welcome stranger! Click here to login or here to register.