Welcome! Click here to login or here to register.
Home
Pathways
Proteins
Catalytic RNA molecules
Enzymatic complexes
Structures
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

H/ACA ribonucleoprotein complex subunit 4

 
Known also as: Centromere-binding factor 5,Centromere/microtubule-binding protein CBF5,H/ACA snoRNP protein CBF5,Small nucleolar RNP protein CBF5,p64'

Known abbreviations: CBF5, YLR175W, L9470.11

 

FUNCTION:
 
Plays a central role in ribosomal RNA processing. Probable catalytic subunit of H/ACA small nucleolar ribonucleoprotein (H/ACA snoRNP) complex, which catalyzes pseudouridylation of rRNA. This involves the isomerization of uridine such that the ribose is subsequently attached to C5, instead of the normal N1. Pseudouridine ('psi') residues may serve to stabilize the conformation of rRNAs. May function as a pseudouridine synthase. Binds in vitro to centromeres and microtubules. It is a centromeric DNA-CBF3-binding factor which is involved in mitotic chromosome segregation. Essential for cell growth. 
 
CATALYTIC ACTIVITY:
 
RNA uridine = RNA pseudouridine.
 
SUBUNIT STRUCTURE:
 
Component of the small nucleolar ribonucleoprotein particles containing H/ACA-type snoRNAs (H/ACA snoRNPs). The protein component of the H/ACA snoRNP contains CBF5, GAR1, NHP2 and NOP10. The complex contains a stable core composed of CBF5 and NOP10, to which GAR1 and NHP2 subsequently bind. Also interacts with NAF1 and SHQ1, which may be required for assembly of H/ACA snoRNP complexes. May also associate with the CBF3 110 kDa subunit (CBF2). Interacts with the trimethylguanosine synthase (TGS1) and with NOP53.
 
CELLULAR LOCALIZATION:
 
Nucleus › nucleolus. Chromosome › centromere. Cytoplasm › cytoskeleton Probable 



This protein can be a part of a given complexes: Activities in which H/ACA ribonucleoprotein complex subunit 4 is involved: Pathways in which H/ACA ribonucleoprotein complex subunit 4 is involved:

NCBI GI number(s): 6323204
296146715
Species: Saccharomyces cerevisiae

Links to other databases:

Database ID Link
Uniprot P33322 P33322
BRENDA - -
KEGG - -
PFAM: PF08068
PF01472
PF01509
PF08068
PF01472
PF01509
InterPro: IPR012960
IPR002501
IPR020103
IPR002478
IPR015947
IPR004802
IPR004521
IPR012960
IPR002501
IPR020103
IPR002478
IPR015947
IPR004802
IPR004521
CATH: - -
SCOP: - -
Solved crystal structures: 3ZV0
3U28
3UAI
[PDB] [details]
[PDB] [details]
[PDB] [details]


Protein sequence:
MSKEDFVIKPEAAGASTDTSEWPLLLKNFDKLLVRSGHYTPIPAGSSPLK
RDLKSYISSGVINLDKPSNPSSHEVVAWIKRILRCEKTGHSGTLDPKVTG
CLIVCIDRATRLVKSQQGAGKEYVCIVRLHDALKDEKDLGRSLENLTGAL
FQRPPLISAVKRQLRVRTIYESNLIEFDNKRNLGVFWASCEAGTYMRTLC
VHLGMLLGVGGHMQELRRVRSGALSENDNMVTLHDVMDAQWVYDNTRDES
YLRSIIQPLETLLVGYKRIVVKDSAVNAVCYGAKLMIPGLLRYEEGIELY
DEIVLITTKGEAIAVAIAQMSTVDLASCDHGVVASVKRCIMERDLYPRRW
GLGPVAQKKKQMKADGKLDKYGRVNENTPEQWKKEYVPLDNAEQSTSSSQ
ETKETEEEPKKAKEDSLIKEVETEKEEVKEDDSKKEKKEKKDKKEKKEKK
EKKDKKEKKEKKEKKRKSEDGDSEEKKSKKSKK

H/ACA ribonucleoprotein complex subunit 4 (Saccharomyces cerevisiae) is product of expression of CBF5 pseudouridine synthase CBF5 gene.

References:

Title Authors Journal Publication date (Issue) PubMed ID
Global analysis of protein localization in budding yeast. Huh WK, Falvo JV, Gerke LC, Carroll AS, Howson RW, Weissman JS, O'Shea EK Nature 2003-10-16 (425) 14562095
The nucleotide sequence of Saccharomyces cerevisiae chromosome XII. Johnston M, Hillier L, Riles L, Albermann K, Andre B, Ansorge W, Benes V, Bruckner M, Delius H, Dubois E, Dusterhoft A, Entian KD, Floeth M, Goffeau A, Hebling U, Heumann K, Heuss-Neitzel D, Hilbert H, Hilger F, Kleine K, Kotter P, Louis EJ, Messenguy F, Mewes HW, Hoheisel JD, et al. Nature 1997-05-01 (387) 9169871
Global analysis of protein expression in yeast. Ghaemmaghami S, Huh WK, Bower K, Howson RW, Belle A, Dephoure N, O'Shea EK, Weissman JS Nature 2003-10-16 (425) 14562106
Large-scale phosphorylation analysis of alpha-factor-arrested Saccharomyces cerevisiae. Li X, Gerber SA, Rudner AD, Beausoleil SA, Haas W, Villen J, Elias JE, Gygi SP J Proteome Res 2007-03-01 (6) 17330950
A multidimensional chromatography technology for in-depth phosphoproteome analysis. Albuquerque CP, Smolka MB, Payne SH, Bafna V, Eng J, Zhou H Mol Cell Proteomics 2008-07-01 (7) 18407956
Proteome-wide identification of in vivo targets of DNA damage checkpoint kinases. Smolka MB, Albuquerque CP, Chen SH, Zhou H Proc Natl Acad Sci U S A 2007-06-19 (104) 17563356
Analysis of phosphorylation sites on proteins from Saccharomyces cerevisiae by electron transfer dissociation (ETD) mass spectrometry. Chi A, Huttenhower C, Geer LY, Coon JJ, Syka JE, Bai DL, Shabanowitz J, Burke DJ, Troyanskaya OG, Hunt DF Proc Natl Acad Sci U S A 2007-01-13 (104) 17287358
Cbf5p, a potential pseudouridine synthase, and Nhp2p, a putative RNA-binding protein, are present together with Gar1p in all H BOX/ACA-motif snoRNPs and constitute a common bipartite structure. Watkins NJ, Gottschalk A, Neubauer G, Kastner B, Fabrizio P, Mann M, Luhrmann R... RNA 1998-12-01 (4) 9848653
The Shq1p.Naf1p complex is required for box H/ACA small nucleolar ribonucleoprotein particle biogenesis. Yang PK, Rotondo G, Porras T, Legrain P, Chanfreau G... J Biol Chem 2002-11-22 (277) 12228251
Naf1 p is a box H/ACA snoRNP assembly factor. Fatica A, Dlakic M, Tollervey D... RNA 2002-12-01 (8) 12515383
Cbf5p, the putative pseudouridine synthase of H/ACA-type snoRNPs, can form a complex with Gar1p and Nop10p in absence of Nhp2p and box H/ACA snoRNAs. Henras AK, Capeyrou R, Henry Y, Caizergues-Ferrer M... RNA 2004-11-01 (10) 15388873
An essential yeast protein, CBF5p, binds in vitro to centromeres and microtubules. Jiang W, Middleton K, Yoon HJ, Fouquet C, Carbon J... Mol Cell Biol 1993-08-01 (13) 8336724
The yeast nucleolar protein Cbf5p is involved in rRNA biosynthesis and interacts genetically with the RNA polymerase I transcription factor RRN3. Cadwell C, Yoon HJ, Zebarjadian Y, Carbon J... Mol Cell Biol 1997-10-01 (17) 9315678
The box H + ACA snoRNAs carry Cbf5p, the putative rRNA pseudouridine synthase. Lafontaine DL, Bousquet-Antonelli C, Henry Y, Caizergues-Ferrer M, Tollervey D... Genes Dev 1998-01-15 (12) 9472021
Point mutations in yeast CBF5 can abolish in vivo pseudouridylation of rRNA. Zebarjadian Y, King T, Fournier MJ, Clarke L, Carbon J... Mol Cell Biol 1999-11-01 (19) 10523634
Hypermethylation of the cap structure of both yeast snRNAs and snoRNAs requires a conserved methyltransferase that is localized to the nucleolus. Mouaikel J, Verheggen C, Bertrand E, Tazi J, Bordonne R... Mol Cell 2002-04-01 (9) 11983179
Nop53p is a novel nucleolar 60S ribosomal subunit biogenesis protein. Sydorskyy Y, Dilworth DJ, Halloran B, Yi EC, Makhnevych T, Wozniak RW, Aitchison JD... Biochem J 2005-06-15 (388) 15686447



Add your own comment!


There are no comments yet.

Last modification of this entry: April 26, 2013.

Welcome stranger! Click here to login or here to register.