Welcome! Click here to login or here to register.
Home
Pathways
Proteins
Catalytic RNA molecules
Enzymatic complexes
Structures
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

H/ACA ribonucleoprotein complex subunit 3

 
Known also as: Nucleolar protein 10,Nucleolar protein family A member 3,snoRNP protein NOP10

Known abbreviations: NOP10,YHR072W-A

FUNCTION:

Required for ribosome biogenesis. Part of a complex which catalyzes pseudouridylation of rRNA. This involves the isomerization of uridine such that the ribose is subsequently attached to C5, instead of the normal N1. Pseudouridine ("psi") residues may serve to stabilize the conformation of rRNAs. Essential for growth.

SUBUNIT STRUCTURE:

Component of the small nucleolar ribonucleoprotein particles containing H/ACA-type snoRNAs (H/ACA snoRNPs). The protein component of the H/ACA snoRNP contains CBF5, GAR1, NHP2 and NOP10. The complex contains a stable core composed of CBF5 and NOP10, to which GAR1 and NHP2 subsequently bind.

CELLULAR LOCALIZATION: 

Nucleus › nucleolus




This protein can be a part of a given complexes: Activities in which H/ACA ribonucleoprotein complex subunit 3 is involved: Pathways in which H/ACA ribonucleoprotein complex subunit 3 is involved:

NCBI GI number(s): 7839181
296145450
Species: Saccharomyces cerevisiae

Links to other databases:

Database ID Link
Uniprot Q6Q547 Q6Q547
BRENDA - -
KEGG - -
PFAM: PF04135
PF04135
InterPro: IPR007264
IPR007264
CATH: - -
SCOP: - -
Solved crystal structures: 1Y2Y
2AQA
3U28
3UAI
[PDB] [details]
[PDB] [details]
[PDB] [details]
[PDB] [details]


Protein sequence:
MHLMYTLGPDGKRIYTLKKVTESGEITKSAHPARFSPDDKYSRQRVTLKK
RFGLVPGQ

H/ACA ribonucleoprotein complex subunit 3 (Saccharomyces cerevisiae) is product of expression of NOP10 gene.

References:

Title Authors Journal Publication date (Issue) PubMed ID
Global analysis of protein localization in budding yeast. Huh WK, Falvo JV, Gerke LC, Carroll AS, Howson RW, Weissman JS, O'Shea EK Nature 2003-10-16 (425) 14562095
Complete nucleotide sequence of Saccharomyces cerevisiae chromosome VIII. Johnston M, Andrews S, Brinkman R, Cooper J, Ding H, Dover J, Du Z, Favello A, Fulton L, Gattung S, et al. Science 1994-09-01 (265) 8091229
Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae. Hu Y, Rolfs A, Bhullar B, Murthy TV, Zhu C, Berger MF, Camargo AA, Kelley F, McCarron S, Jepson D, Richardson A, Raphael J, Moreira D, Taycher E, Zuo D, Mohr S, Kane MF, Williamson J, Simpson A, Bulyk ML, Harlow E, Marsischky G, Kolodner RD, LaBaer J Genome Res 2007-04-01 (17) 17322287
Analysis of phosphorylation sites on proteins from Saccharomyces cerevisiae by electron transfer dissociation (ETD) mass spectrometry. Chi A, Huttenhower C, Geer LY, Coon JJ, Syka JE, Bai DL, Shabanowitz J, Burke DJ, Troyanskaya OG, Hunt DF Proc Natl Acad Sci U S A 2007-01-13 (104) 17287358
Nhp2p and Nop10p are essential for the function of H/ACA snoRNPs. Henras A, Henry Y, Bousquet-Antonelli C, Noaillac-Depeyre J, Gelugne JP, Caizergues-Ferrer M... EMBO J 1998-12-01 (17) 9843512
Cbf5p, the putative pseudouridine synthase of H/ACA-type snoRNPs, can form a complex with Gar1p and Nop10p in absence of Nhp2p and box H/ACA snoRNAs. Henras AK, Capeyrou R, Henry Y, Caizergues-Ferrer M... RNA 2004-11-01 (10) 15388873



Add your own comment!


There are no comments yet.

Last modification of this entry: April 26, 2013.

Welcome stranger! Click here to login or here to register.