Welcome! Click here to login or here to register.
Home
Pathways
Proteins
Catalytic RNA molecules
Enzymatic complexes
Structures
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

H/ACA ribonucleoprotein complex subunit 2

 
Known also as: H/ACA snoRNP protein NHP2,High mobility group-like nuclear protein 2

Known abbreviations: NHP2,YDL208W,D1045

FUNCTION:

Required for ribosome biogenesis. Part of a complex which catalyzes pseudouridylation of rRNA. This involves the isomerization of uridine such that the ribose is subsequently attached to C5, instead of the normal N1. Pseudouridine ("psi") residues may serve to stabilize the conformation of rRNAs. Essential for growth. Directly binds H/ACA snoRNAs.

SUBUNIT STRUCTURE:

Component of the small nucleolar ribonucleoprotein particles containing H/ACA-type snoRNAs (H/ACA snoRNPs). The protein component of the H/ACA snoRNP contains CBF5, GAR1, NHP2 and NOP10. The complex contains a stable core composed of CBF5 and NOP10, to which GAR1 and NHP2 subsequently bind. Interacts with SHQ1. 

CELLULAR LOCALIZATION:

Nucleus › nucleolus




This protein can be a part of a given complexes: Activities in which H/ACA ribonucleoprotein complex subunit 2 is involved: Pathways in which H/ACA ribonucleoprotein complex subunit 2 is involved:

NCBI GI number(s): 82795243
296143164
Species: Saccharomyces cerevisiae

Links to other databases:

Database ID Link
Uniprot P32495 P32495
BRENDA - -
KEGG - -
PFAM: PF01248
PF01248
InterPro: IPR002415
IPR004038
IPR018492
IPR004037
IPR002415
IPR004038
IPR018492
IPR004037
CATH: - -
SCOP: - -
Solved crystal structures: 2LBW
2LBX
[PDB] [details]
[PDB] [details]


Protein sequence:
MGKDNKEHKESKESKTVDNYEARMPAVLPFAKPLASKKLNKKVLKTVKKA
SKAKNVKRGVKEVVKALRKGEKGLVVIAGDISPADVISHIPVLCEDHSVP
YIFIPSKQDLGAAGATKRPTSVVFIVPGSNKKKDGKNKEEEYKESFNEVV
KEVQAL

H/ACA ribonucleoprotein complex subunit 2 (Saccharomyces cerevisiae) is product of expression of NHP2 gene.

References:

Title Authors Journal Publication date (Issue) PubMed ID
Global analysis of protein localization in budding yeast. Huh WK, Falvo JV, Gerke LC, Carroll AS, Howson RW, Weissman JS, O'Shea EK Nature 2003-10-16 (425) 14562095
The nucleotide sequence of Saccharomyces cerevisiae chromosome IV. Jacq C, Alt-Morbe J, Andre B, Arnold W, Bahr A, Ballesta JP, Bargues M, Baron L, Becker A, Biteau N, Blocker H, Blugeon C, Boskovic J, Brandt P, Bruckner M, Buitrago MJ, Coster F, Delaveau T, del Rey F, Dujon B, Eide LG, Garcia-Cantalejo JM, Goffeau A, Gomez-Peris A, Zaccaria P, et al. Nature 1997-05-01 (387) 9169867
Accumulation of H/ACA snoRNPs depends on the integrity of the conserved central domain of the RNA-binding protein Nhp2p. Henras A, Dez C, Noaillac-Depeyre J, Henry Y, Caizergues-Ferrer M... Nucleic Acids Res 2001-07-01 (29) 11433018
Nhp2p and Nop10p are essential for the function of H/ACA snoRNPs. Henras A, Henry Y, Bousquet-Antonelli C, Noaillac-Depeyre J, Gelugne JP, Caizergues-Ferrer M... EMBO J 1998-12-01 (17) 9843512
Sequence and genetic analysis of NHP2: a moderately abundant high mobility group-like nuclear protein with an essential function in Saccharomyces cerevisiae. Kolodrubetz D, Burgum A... Yeast 1991-01-01 (7) 2063628
The nucleotide sequence of a 39 kb segment of yeast chromosome IV: 12 new open reading frames, nine known genes and one genes for Gly-tRNA. Bahr A, Moller-Rieker S, Hankeln T, Kraemer C, Protin U, Schmidt ER... Yeast 1997-01-01 (13) 9046097
Cbf5p, a potential pseudouridine synthase, and Nhp2p, a putative RNA-binding protein, are present together with Gar1p in all H BOX/ACA-motif snoRNPs and constitute a common bipartite structure. Watkins NJ, Gottschalk A, Neubauer G, Kastner B, Fabrizio P, Mann M, Luhrmann R... RNA 1998-12-01 (4) 9848653
The Shq1p.Naf1p complex is required for box H/ACA small nucleolar ribonucleoprotein particle biogenesis. Yang PK, Rotondo G, Porras T, Legrain P, Chanfreau G... J Biol Chem 2002-11-22 (277) 12228251
Naf1 p is a box H/ACA snoRNP assembly factor. Fatica A, Dlakic M, Tollervey D... RNA 2002-12-01 (8) 12515383
Cbf5p, the putative pseudouridine synthase of H/ACA-type snoRNPs, can form a complex with Gar1p and Nop10p in absence of Nhp2p and box H/ACA snoRNAs. Henras AK, Capeyrou R, Henry Y, Caizergues-Ferrer M... RNA 2004-11-01 (10) 15388873



Add your own comment!


There are no comments yet.

Last modification of this entry: April 26, 2013.

Welcome stranger! Click here to login or here to register.