Welcome! Click here to login or here to register.
Home
Pathways
Proteins
Catalytic RNA molecules
Enzymatic complexes
Structures
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

Nucleolar protein 56

 
Known also as: Ribosome biosynthesis protein SIK1,Suppressor of I kappa b protein 1

Known abbreviations: NOP56,SIK1,YLR197W,L8167.9

FUNCTION:

Required for 60S ribosomal subunit synthesis.

SUBUNIT STRUCTURE:

Interacts with NOP1 and NOP58. Component of the ribosomal small subunit (SSU) processome composed of at least 40 protein subunits and snoRNA U3.

CELLULAR LOCALIZATION: 

Nucleus › nucleolus




This protein can be a part of a given complexes: Activities in which Nucleolar protein 56 is involved: Pathways in which Nucleolar protein 56 is involved:

NCBI GI number(s): 6323226
296146736
Species: Saccharomyces cerevisiae

Links to other databases:

Database ID Link
Uniprot - -
BRENDA - -
KEGG - -
PFAM: PF01798
PF08156
PF08060
PF01798
PF08156
PF08060
InterPro: IPR012974
IPR012976
IPR002687
IPR012974
IPR012976
IPR002687
CATH: - -
SCOP: - -


Protein sequence:
MAPIEYLLFEEPTGYAVFKVKLQQDDIGSRLKEVQEQINDFGAFTKLIEL
VSFAPFKGAAEALENANDISEGLVSESLKAILDLNLPKASSKKKNITLAI
SDKNLGPSIKEEFPYVDCISNELAQDLIRGVRLHGEKLFKGLQSGDLERA
QLGLGHAYSRAKVKFSVQKNDNHIIQAIALLDQLDKDINTFAMRVKEWYG
WHFPELAKLVPDNYTFAKLVLFIKDKASLNDDSLHDLAALLNEDSGIAQR
VIDNARISMGQDISETDMENVCVFAQRVASLADYRRQLYDYLCEKMHTVA
PNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKG
NTPKYGLIYHSGFISKASAKNKGRISRYLANKCSMASRIDNYSEEPSNVF
GSVLKKQVEQRLEFYNTGKPTLKNELAIQEAMELYNKDKPAAEVEETKEK
ESSKKRKLEDDDEEKKEKKEKKSKKEKKEKKEKKDKKEKKDKKEKKDKKK
KSKD

Nucleolar protein 56 (Saccharomyces cerevisiae) is product of expression of NOP56 gene.



Add your own comment!


There are no comments yet.

Last modification of this entry: April 26, 2013.

Welcome stranger! Click here to login or here to register.