Welcome! Click here to login or here to register.
Home
Pathways
Proteins
Catalytic RNA molecules
Enzymatic complexes
Structures
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

13 kDa ribonucleoprotein-associated protein

 
Known also as: Small nuclear ribonucleoprotein-associated protein 1

Known abbreviations: SNU13, YEL026W

FUNCTION:

Common component of the spliceosome and rRNA processing machinery. In association with the spliceosomal U4/U6.U5 tri-snRNP particle, required for splicing of pre-mRNA. In association with box C/D snoRNPs, required for processing of pre-ribosomal RNA (rRNA) and site-specific 2'-O-methylation of substrate RNAs. Essential for the accumulation and stability of U4 snRNA, U6 snRNA, and box C/D snoRNAs. 

SUBUNIT STRUCTURE:

Subunit structure Binds to the C'/D and B/C motifs in U3 snoRNA. Component of the U4/U6-U5 tri-snRNP complex composed of the U4, U6 and U5 snRNAs and at least PRP3, PRP4, PRP6, PRP8, PRP18, PRP31, PRP38, SNU13, SNU23, SNU66, SNU114, SPP381, SMB1, SMD1, SMD2, SMD3, SMX2, SMX3, LSM2, LSM3, LSM4, LSM5, LSM6, LSM7, LSM8, BRR2 and DIB1. Binds to the 5'-stem-loop of U4 snRNA. Component of the ribosomal small subunit (SSU) processome composed of at least 40 protein subunits and snoRNA U3. 

CELLULAR LOCALIZATION: 

Nucleus › nucleolus.




This protein can be a part of a given complexes: Activities in which 13 kDa ribonucleoprotein-associated protein is involved: Pathways in which 13 kDa ribonucleoprotein-associated protein is involved:

NCBI GI number(s): 6320809
296143929
Species: Saccharomyces cerevisiae

Links to other databases:

Database ID Link
Uniprot - -
BRENDA - -
KEGG - -
PFAM: PF01248
PF01248
InterPro: IPR002415
IPR004038
IPR018492
IPR004037
IPR002415
IPR004038
IPR018492
IPR004037
CATH: - -
SCOP: - -


Protein sequence:
MSAPNPKAFPLADAALTQQILDVVQQAANLRQLKKGANEATKTLNRGISE
FIIMAADCEPIEILLHLPLLCEDKNVPYVFVPSRVALGRACGVSRPVIAA
SITTNDASAIKTQIYAVKDKIETLLI

13 kDa ribonucleoprotein-associated protein (Saccharomyces cerevisiae) is product of expression of SNU13 gene.



Add your own comment!


There are no comments yet.

Last modification of this entry: April 26, 2013.

Welcome stranger! Click here to login or here to register.