Welcome! Click here to login or here to register.
Home
Pathways
Proteins
Catalytic RNA molecules
Enzymatic complexes
Structures
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

Nuclear nucleic acid-binding protein C1D

 
Known abbreviations: hC1D, C1D

FUNCTION: 

Plays a role in the recruitment of the RNA exosome complex to pre-rRNA to mediate the 3'-5' end processing of the 5.8S rRNA; this function may include MPHOSPH6. Can activate PRKDC not only in the presence of linear DNA but also in the presence of supercoiled DNA. Can induce apoptosis in a p53/TP53 dependent manner. May regulate the TRAX/TSN complex formation. Potentiates transcriptional repression by NR1D1 and THRB By similarity.  

SUBUNIT STRUCTURE:

Monomer and homodimer. Interacts with NR1D1, THRA, THRB, NCOR1 and NCOR2 By similarity. Interacts with EXOSC10; the interaction probably mediates the association with the nuclear form of the RNA exosome. The homodimeric form interacts with TSNAX following gamma-radiation. Interacts with RAC3. 

CELLULAR LOCALIZATION:

Cytoplasm. Nucleus › nucleolus. Note: EXOSC10 is required for nucleolar localization. 

TISSUE SPECIFICITY:

Ubiquitous. Expressed at very high levels in the hippocampus, medulla oblongata, mammary gland, thyroid and salivary gland. Expressed at high levels in the fetal; lung, liver and kidney. Expressed at low levels in skeletal muscle, appendix, heart, lung and colon. Ref.8 Induction By gamma-radiation. 

POST_TRANSLATIONAL MODIFICATION:

Phosphorylated by PRKDC.




Activities in which Nuclear nucleic acid-binding protein C1D is involved: Pathways in which Nuclear nucleic acid-binding protein C1D is involved:

NCBI GI number(s): 298231253
298231252
298231256
298231255
5453583
223468650
27894373
223468655
Species: Homo sapiens

Links to other databases:

Database ID Link
Uniprot Q13901 Q13901
BRENDA - -
KEGG hsa:10438 hsa:10438
PFAM: PF04000
PF04000
InterPro: IPR011082
IPR007146
IPR011082
IPR007146
CATH: - -
SCOP: - -


Protein sequence:
MAGEEINEDYPVEIHEYLSAFENSIGAVDEMLKTMMSVSRNELLQKLDPL
EQAKVDLVSAYTLNSMFWVYLATQGVNPKEHPVKQELERIRVYMNRVKEI
TDKKKAGKLDRGAASRFVKNALWEPKSKNASKVANKGKSKS

Nuclear nucleic acid-binding protein C1D (Homo sapiens) is product of expression of C1D gene.



Add your own comment!


There are no comments yet.

Last modification of this entry: April 26, 2013.

Welcome stranger! Click here to login or here to register.