Welcome! Click here to login or here to register.
Home
Pathways
Proteins
Catalytic RNA molecules
Enzymatic complexes
Structures
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

Piwi-like protein 4

 
Known abbreviations: PIWI4

Function

Plays a central role during spermatogenesis by repressing transposable elements and prevent their mobilization, which is essential for the germline integrity. Acts via the piRNA metabolic process, which mediates the repression of transposable elements during meiosis by forming complexes composed of piRNAs and Piwi proteins and govern the methylation and subsequent repression of transposons. Directly binds piRNAs, a class of 24 to 30 nucleotide RNAs that are generated by a Dicer-independent mechanism and are primarily derived from transposons and other repeated sequence elements. Associates with secondary piRNAs antisense and PIWIL2/MILI is required for such association. The piRNA process acts upstream of known mediators of DNA methylation. Participates in a piRNA amplification loop. Besides their function in transposable elements repression, piRNAs are probably involved in other processes during meiosis such as translation regulation. May be involved in the chromatin-modifying pathway by inducing 'Lys-9' methylation of histone H3 at some loci.

Subunit structure

Interacts with PRMT5 and WDR77. Interacts (when methylated on arginine residues) with TDRD1, TDRKH/TDRD2 and TDRD9.

Subcellular location

Nucleus. Cytoplasm. Note: Probable component of the meiotic nuage, also named P granule, a germ-cell-specific organelle required to repress transposon during meiosis. PIWIL2/MILI is required for nuclear localization.

Tissue specificity

Expressed in testis. According to, it is ubiquitously expressed.

Post-translational modification

Arginine methylation by PRMT5 is required for the interaction with Tudor domain-containing protein (TDRD1, TDRKH/TDRD2 and TDRD9) and subsequent localization to the meiotic nuage, also named P granule.

Sequence similarities

Belongs to the argonaute family. Piwi subfamily.

Contains 1 PAZ domain.

Contains 1 Piwi domain.




Activities in which Piwi-like protein 4 is involved: Pathways in which Piwi-like protein 4 is involved:

NCBI GI number(s): -
Species: Homo sapiens

Links to other databases:

Database ID Link
Uniprot Q7Z3Z4 Q7Z3Z4
BRENDA - -
KEGG hsa:143689 hsa:143689
PFAM: PF02170
PF02171
PF02170
PF02171
InterPro: IPR003100
IPR003165
IPR012337
IPR003100
IPR003165
IPR012337
CATH: - -
SCOP: - -


Protein sequence:
MSGRARVKARGIARSPSATEVGRIQASPLPRSVDLSNNEASSSNGFLGTS
RISTNDKYGISSGDAGSTFMERGVKNKQDFMDLSICTREKLAHVRNCKTG
SSGIPVKLVTNLFNLDFPQDWQLYQYHVTYIPDLASRRLRIALLYSHSEL
SNKAKAFDGAILFLSQKLEEKVTELSSETQRGETIKMTITLKRELPSSSP
VCIQVFNIIFRKILKKLSMYQIGRNFYNPSEPMEIPQHKLSLWPGFAISV
SYFERKLLFSADVSYKVLRNETVLEFMTALCQRTGLSCFTQTCEKQLIGL
IVLTRYNNRTYSIDDIDWSVKPTHTFQKRDGTEITYVDYYKQQYDITVSD
LNQPMLVSLLKKKRNDNSEAQLAHLIPELCFLTGLTDQATSDFQLMKAVA
EKTRLSPSGRQQRLARLVDNIQRNTNARFELETWGLHFGSQISLTGRIVP
SEKILMQDHICQPVSAADWSKDIRTCKILNAQSLNTWLILCSDRTEYVAE
SFLNCLRRVAGSMGFNVDYPKIIKVQENPAAFVRAIQQYVDPDVQLVMCI
LPSNQKTYYDSIKKYLSSDCPVPSQCVLARTLNKQGMMMSIATKIAMQMT
CKLGGELWAVEIPLKSLMVVGIDVCKDALSKDVMVVGCVASVNPRITRWF
SRCILQRTMTDVADCLKVFMTGALNKWYKYNHDLPARIIVYRAGVGDGQL
KTLIEYEVPQLLSSVAESSSNTSSRLSVIVVRKKCMPRFFTEMNRTVQNP
PLGTVVDSEATRNEWYDFYLISQVACRGTVSPTYYNVIYDDNGLKPDHMQ
RLTFKLCHLYYNWPGIVSVPAPCQYAHKLTFLVAQSIHKEPSLELANHLF
YL

Piwi-like protein 4 (Homo sapiens) is product of expression of piwi-like RNA-mediated gene silencing 4 gene.



Add your own comment!


There are no comments yet.

Last modification of this entry: April 30, 2013.

Welcome stranger! Click here to login or here to register.