Welcome! Click here to login or here to register.
Home
Pathways
Proteins
Catalytic RNA molecules
Enzymatic complexes
Structures
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

U3 small nucleolar RNA-interacting protein 2

 
Known also as: RRP9 homolog, U3 small nucleolar ribonucleoprotein-associated 55 kDa protein

Known abbreviations: RRP9, 15.5K

Function

Component of a nucleolar small nuclear ribonucleoprotein particle (snoRNP) thought to participate in the processing and modification of pre-ribosomal RNA.

Subunit structure

Interacts specifically with the U3 small nucleolar RNA (U3 snoRNA). Binds a sub-fragment of the U3 snoRNA surrounding the B/C motif (3UBC). This association with the U3BC RNA is dependent on the binding of a protein called 15.5K to the box B/C motif. The association of the protein with the U3BC RNA was found to be also dependent on a conserved RNA structure that flanks the box B/C motif.

Subcellular location

Nucleus › nucleolus.

Domain

The WD domains are required for nucleolar localization and U3 small nucleolar RNAs binding.

Sequence similarities

Belongs to the WD repeat RRP9 family.

Contains 7 WD repeats.




Activities in which U3 small nucleolar RNA-interacting protein 2 is involved: Pathways in which U3 small nucleolar RNA-interacting protein 2 is involved:

NCBI GI number(s): -
Species: Homo sapiens

Links to other databases:

Database ID Link
Uniprot O43818 O43818
BRENDA - -
KEGG hsa:9136 hsa:9136
PFAM: PF00400
PF00400
InterPro: IPR020472
IPR015943
IPR001680
IPR017986
IPR019775.
IPR020472
IPR015943
IPR001680
IPR017986
IPR019775.
CATH: - -
SCOP: - -


Protein sequence:
MSATAAARKRGKPASGAGAGAGAGKRRRKADSAGDRGKSKGGGKMNEEIS
SDSESESLAPRKPEEEEEEELEETAQEKKLRLAKLYLEQLRQQEEEKAEA
RAFEEDQVAGRLKEDVLEQRGRLQKLVAKEIQAPASADIRVLRGHQLSIT
CLVVTPDDSAIFSAAKDCSIIKWSVESGRKLHVIPRAKKGAEGKPPGHSS
HVLCMAISSDGKYLASGDRSKLILIWEAQSCQHLYTFTGHRDAVSGLAFR
RGTHQLYSTSHDRSVKVWNVAENSYVETLFGHQDAVAALDALSRECCVTA
GGRDGTVRVWKIPEESQLVFYGHQGSIDCIHLINEEHMVSGADDGSVALW
GLSKKRPLALQREAHGLRGEPGLEQPFWISSVAALLNTDLVATGSHSSCV
RLWQCGEGFRQLDLLCDIPLVGFINSLKFSSSGDFLVAGVGQEHRLGRWW
RIKEARNSVCIIPLRRVPVPPAAGS

U3 small nucleolar RNA-interacting protein 2 (Homo sapiens) is product of expression of RRP9 ribosomal RNA processing 9, small subunit (SSU) processome component gene.



Add your own comment!


There are no comments yet.

Last modification of this entry: May 1, 2013.

Welcome stranger! Click here to login or here to register.