Welcome! Click here to login or here to register.
Home
Pathways
Proteins
Catalytic RNA molecules
Enzymatic complexes
Structures
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

rRNA 2'-O-methyltransferase fibrillarin

 
Known also as: 34 kDa nucleolar scleroderma antigen

Known abbreviations: FIB, FBL

Function

Involved in pre-rRNA processing. Utilizes the methyl donor S-adenosyl-L-methionine to catalyze the site-specific 2'-hydroxyl methylation of ribose moieties in pre-ribosomal RNA. Site specificity is provided by a guide RNA that base pairs with the substrate. Methylation occurs at a characteristic distance from the sequence involved in base pairing with the guide RNA.

Subunit structure

Interacts with NOLC. Component of box C/D small nucleolar ribonucleoprotein (snoRNP) particles that contain NHP2L1, FBL, NOP5 and NOP56, plus a guide RNA. It is associated with the U3, U8, U13, X and Y small nuclear RNAs. Component of several ribosomal and nucleolar protein complexes. Interacts with PRMT5 and UTP20. Interacts with DDX5 and C1QBP.

Subcellular location

Nucleus › nucleolus. Note: Fibrillar region of the nucleolus.

Post-translational modification

By homology to other fibrillarins, some or all of the N-terminal domain arginines are modified to asymmetric dimethylarginine (DMA).

Sequence similarities

Belongs to the methyltransferase superfamily. Fibrillarin family.




Activities in which rRNA 2'-O-methyltransferase fibrillarin is involved: Pathways in which rRNA 2'-O-methyltransferase fibrillarin is involved:

NCBI GI number(s): -
Species: Homo sapiens

Links to other databases:

Database ID Link
Uniprot P22087 P22087
BRENDA - -
KEGG hsa:2091 hsa:2091
PFAM: PF01269
PF01269
InterPro: IPR000692
IPR020813
IPR000692
IPR020813
CATH: - -
SCOP: - -


Protein sequence:
MKPGFSPRGGGFGGRGGFGDRGGRGGRGGFGGGRGRGGGFRGRGRGGGGG
GGGGGGGGRGGGGFHSGGNRGRGRGGKRGNQSGKNVMVEPHRHEGVFICR
GKEDALVTKNLVPGESVYGEKRVSISEGDDKIEYRAWNPFRSKLAAAILG
GVDQIHIKPGAKVLYLGAASGTTVSHVSDIVGPDGLVYAVEFSHRSGRDL
INLAKKRTNIIPVIEDARHPHKYRMLIAMVDVIFADVAQPDQTRIVALNA
HTFLRNGGHFVISIKANCIDSTASAEAVFASEVKKMQQENMKPQEQLTLE
PYERDHAVVVGVYRPPPKVKN

RRNA 2'-O-methyltransferase fibrillarin (Homo sapiens) is product of expression of fibrillarin gene.



Add your own comment!


There are no comments yet.

Last modification of this entry: May 1, 2013.

Welcome stranger! Click here to login or here to register.