Welcome! Click here to login or here to register.
Home
Pathways
Proteins
Catalytic RNA molecules
Enzymatic complexes
Structures
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

H/ACA ribonucleoprotein complex non-core subunit NAF1

 
Known abbreviations: NAF1

Function

RNA-binding protein required for the maturation of box H/ACA snoRNPs complex and ribosome biogenesis. During assembly of the H/ACA snoRNPs complex, it associates with the complex and disappears during maturation of the complex and is replaced by NOLA1/GAR1 to yield mature H/ACA snoRNPs complex. Probably competes with NOLA1/GAR1 for binding with DKC1/NOLA4.

Subunit structure

During assembly of the complex, component of the small nucleolar ribonucleoprotein particles containing H/ACA-type snoRNAs (H/ACA snoRNPs) which contains NOLA2/NHP2, NOLA3/NOP10, NAF1 and DKC1/NOLA4. Interacts directly with DKC1/NOLA4.

Subcellular location

Cytoplasm. Nucleus. Note: Shuttles between the cytoplasm and the nucleus. Absent from the nucleolus

Sequence similarities

Belongs to the NAF1 family.




Activities in which H/ACA ribonucleoprotein complex non-core subunit NAF1 is involved: Pathways in which H/ACA ribonucleoprotein complex non-core subunit NAF1 is involved:

NCBI GI number(s): -
Species: Homo sapiens

Links to other databases:

Database ID Link
Uniprot Q96HR8 Q96HR8
BRENDA - -
KEGG hsa:92345 hsa:92345
PFAM: PF04410
PF04410
InterPro: IPR007504
IPR007504
CATH: - -
SCOP: - -


Protein sequence:
MEVVEAAAAQLETLKFNGTDFGVGEGPAAPSPGSAPVPGTQPPLQSFEGS
PDAGQTVEVKPAGEQPLQPVLNAVAAGTPAPQPQPPAESPACGDCVTSPG
AAEPARAPDSLETSDSDSDSDSETDSDSSSSSSSSSSSSSSSSSSCISLP
PVLSDGDDDLQIEKENKNFPLKTKDELLLNELPSVEELTIILPEDIELKP
LGMVSSIIEQLVIIESMTNLPPVNEETVIFKSDRQAAGKIFEIFGPVAHP
FYVLRFNSSDHIESKGIKIKETMYFAPSMKDFTQYIFTEKLKQDKGSDAS
WKNDQEPPPEALDFSDDEKEKEAKQRKKSQIQGRKKLKSEFNEPGEDFTE
VHQNWNAHSSASEHAKGYRNREFTRGFSRARYPRSCHGRPPPQHFYNSEH
MVSQETSGFPSQRQNNPIMPQYPFPLPVFDMHNFPLRPPPPPPPPPVNMG
WATPNMAAHPLLNLPYSLPPPPPPPPLPPPPSSGDSNSHFGPYY

H/ACA ribonucleoprotein complex non-core subunit NAF1 (Homo sapiens) is product of expression of nuclear assembly factor 1 ribonucleoprotein gene.



Add your own comment!


There are no comments yet.

Last modification of this entry: July 17, 2013.

Welcome stranger! Click here to login or here to register.