Welcome! Click here to login or here to register.
Home
Pathways
Proteins
Catalytic RNA molecules
Enzymatic complexes
Structures
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

5'-3' exoribonuclease 2

 
Known also as: DHM1-like protein

Known abbreviations: XRN2

Function

Possesses 5'->3' exoribonuclease activity. May promote the termination of transcription by RNA polymerase II. During transcription termination, cleavage at the polyadenylation site liberates a 5' fragment which is subsequently processed to form the mature mRNA and a 3' fragment which remains attached to the elongating polymerase. The processive degradation of this 3' fragment by this protein may promote termination of transcription.

 

Catalytic activity

Exonucleolytic cleavage in the 5'- to 3'-direction to yield nucleoside 5'-phosphates.

 

Tissue specificity

Expressed in the spleen, thymus, prostate, testis, ovary, small intestine, colon, peripheral blood leukocytes, heart, brain, placenta, lung, liver, skeletal muscle, kidney, and pancreas. Isoform 2 is expressed predominantly in peripheral blood leukocytes

 

Sequence similarities

Belongs to the 5'-3' exonuclease family. XRN2/RAT1 subfamily.

Contains 1 CCHC-type zinc finger.

 

Sequence caution

The sequence AAR24369.1 differs from that shown. Reason: Frameshift at position 73.

The sequence BAA90934.1 differs from that shown. Reason: Erroneous initiation.




Activities in which 5'-3' exoribonuclease 2 is involved: Pathways in which 5'-3' exoribonuclease 2 is involved:

NCBI GI number(s): -
Species: Homo sapiens

Links to other databases:

Database ID Link
Uniprot Q9H0D6 Q9H0D6
BRENDA - -
KEGG hsa:22803 hsa:22803
PFAM: PF03159
PF03159
InterPro: IPR027073
IPR017151
IPR027073
IPR017151
CATH: - -
SCOP: - -


Protein sequence:
MGVPAFFRWLSRKYPSIIVNCVEEKPKECNGVKIPVDASKPNPNDVEFDN
LYLDMNGIIHPCTHPEDKPAPKNEDEMMVAIFEYIDRLFSIVRPRRLLYM
AIDGVAPRAKMNQQRSRRFRASKEGMEAAVEKQRVREEILAKGGFLPPEE
IKERFDSNCITPGTEFMDNLAKCLRYYIADRLNNDPGWKNLTVILSDASA
PGEGEHKIMDYIRRQRAQPNHDPNTHHCLCGADADLIMLGLATHEPNFTI
IREEFKPNKPKPCGLCNQFGHEVKDCEGLPREKKGKHDELADSLPCAEGE
FIFLRLNVLREYLERELTMASLPFTFDVERSIDDWVFMCFFVGNDFLPHL
PSLEIRENAIDRLVNIYKNVVHKTGGYLTESGYVNLQRVQMIMLAVGEVE
DSIFKKRKDDEDSFRRRQKEKRKRMKRDQPAFTPSGILTPHALGSRNSPG
SQVASNPRQAAYEMRMQNNSSPSISPNTSFTSDGSPSPLGGIKRKAEDSD
SEPEPEDNVRLWEAGWKQRYYKNKFDVDAADEKFRRKVVQSYVEGLCWVL
RYYYQGCASWKWYYPFHYAPFASDFEGIADMPSDFEKGTKPFKPLEQLMG
VFPAASGNFLPPSWRKLMSDPDSSIIDFYPEDFAIDLNGKKYAWQGVALL
PFVDERRLRAALEEVYPDLTPEETRRNSLGGDVLFVGKHHPLHDFILELY
QTGSTEPVEVPPELCHGIQGKFSLDEEAILPDQIVCSPVPMLRDLTQNTV
VSINFKDPQFAEDYIFKAVMLPGARKPAAVLKPSDWEKSSNGRQWKPQLG
FNRDRRPVHLDQAAFRTLGHVMPRGSGTGIYSNAAPPPVTYQGNLYRPLL
RGQAQIPKLMSNMRPQDSWRGPPPLFQQQRFDRGVGAEPLLPWNRMLQTQ
NAAFQPNQYQMLAGPGGYPPRRDDRGGRQGYPREGRKYPLPPPSGRYNWN

5'-3' exoribonuclease 2 (Homo sapiens) is product of expression of 5'-3' exoribonuclease 2 gene.



Add your own comment!


There are no comments yet.

Last modification of this entry: Sept. 12, 2013.

Welcome stranger! Click here to login or here to register.