|
Known also as: CCR4-associated factor 1
Known abbreviations: CAF1, Pop2, YNR052C, N3470
[FUNCTION] Acts as probably catalytic component of the CCR4-NOT core complex, which in the nucleus seems to be a general transcription factor, and in the cytoplasm the major mRNA deadenylase involved in mRNA turnover. In vitro, POP2 has 3'-exoribonuclease activity with a preference for poly(A) RNAs, but also degrades poly(U) and poly(C) RNAs. Is part of a glucose-sensing system involved in growth control in response to glucose availability.
[CATALYTIC ACTIVITY]
Exonucleolytic cleavage of poly(A) to 5'-AMP.
[COFACTOR] Divalent metal cations. Mg2+ is the most probable.
[SUBUNIT STRUCTURE ]
Subunit of the 1.0 MDa CCR4-NOT core complex that contains CCR4, CAF1, NOT1, NOT2, NOT3, NOT4, NOT5, CAF40 and CAF130. In the complex interacts with NOT1. The core complex probably is part of a less characterized 1.9 MDa CCR4-NOT complex.
[SUBCELLULAR LOCATION] Cytoplasm. Nucleus
|
This protein can be a part of a given complexes:
Activities in which Poly(A) ribonuclease POP2 is involved:
Pathways in which Poly(A) ribonuclease POP2 is involved:
Links to other databases:
Protein sequence:
MQSMNVQPRVLAVGGEQFFSQRQASEQHQQQNMGPQVYSPKVNRARMFPQ
GMPVNTINGSVNQEMNNAYLLKQKNEPLLTQQQQQQQQQQQPFNIGTPVS
VASLPPGLNVLQQQQQQQQQQQQQQQGVGLNRPLASQLPKHLTNQSMPPI
FLPPPNYLFVRDVWKSNLYSEFAVIRQLVSQYNHVSISTEFVGTLARPIG
TFRSKVDYHYQTMRANVDFLNPIQLGLSLSDANGNKPDNGPSTWQFNFEF
DPKKEIMSTESLELLRKSGINFEKHENLGIDVFEFSQLLMDSGLMMDDSV
TWITYHAAYDLGFLINILMNDSMPNNKEDFEWWVHQYMPNFYDLNLVYKI
IQEFKNPQLQQSSQQQQQQQYSLTTLADELGLPRFSIFTTTGGQSLLMLL
SFCQLSKLSMHKFPNGTDFAKYQGVIYGIDGDQ
|
Poly(A) ribonuclease POP2 (Saccharomyces cerevisiae) is product of expression of
POP2
gene.
Poly(A) ribonuclease POP2 (Saccharomyces cerevisiae) belongs to following protein families:
References:
Title |
Authors |
Journal
| Publication date (Issue)
| PubMed ID
|
The yeast POP2 gene encodes a nuclease involved in mRNA deadenylation. |
Daugeron MC, Mauxion F, Seraphin B |
Nucleic Acids Res
|
2001-06-15 (29) |
11410650 |
The nucleotide sequence of Saccharomyces cerevisiae chromosome XIV and its evolutionary implications. |
Philippsen P, Kleine K, Pohlmann R, Dusterhoft A, Hamberg K, Hegemann JH, Obermaier B, Urrestarazu LA, Aert R, Albermann K |
Nature
|
1997-05-01 (387) |
9169873 |
Purification and characterization of the 1.0 MDa CCR4-NOT complex identifies two novel components of the complex. |
Chen J, Rappsilber J, Chiang YC, Russell P, Mann M, Denis CL |
J Mol Biol
|
2001-12-07 (314) |
11733989 |
Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae. |
Hu Y, Rolfs A, Bhullar B, Murthy TV, Zhu C, Berger MF, Camargo AA, Kelley F, McCarron S, Jepson D, Richardson A, Raphael J, Moreira D, Taycher E, Zuo D, Mohr S, Kane MF, Williamson J, Simpson A, Bulyk ML, Harlow E, Marsischky G, Kolodner RD, LaBaer J |
Genome Res
|
2007-04-01 (17) |
17322287 |
Global analysis of protein expression in yeast. |
Ghaemmaghami S, Huh WK, Bower K, Howson RW, Belle A, Dephoure N, O'Shea EK, Weissman JS |
Nature
|
2003-10-16 (425) |
14562106 |
A multidimensional chromatography technology for in-depth phosphoproteome analysis. |
Albuquerque CP, Smolka MB, Payne SH, Bafna V, Eng J, Zhou H |
Mol Cell Proteomics
|
2008-07-01 (7) |
18407956 |
The NOT proteins are part of the CCR4 transcriptional complex and affect gene expression both positively and negatively. |
Liu HY, Badarinarayana V, Audino DC, Rappsilber J, Mann M, Denis CL |
EMBO J
|
1998-01-16 (17) |
9463387 |
The CCR4 and CAF1 proteins of the CCR4-NOT complex are physically and functionally separated from NOT2, NOT4, and NOT5. |
Bai Y, Salvadore C, Chiang YC, Collart MA, Liu HY, Denis CL |
Mol Cell Biol
|
1999-10-01 (19) |
10490603 |
Identification of a mouse protein whose homolog in Saccharomyces cerevisiae is a component of the CCR4 transcriptional regulatory complex. |
Draper MP, Salvadore C, Denis CL |
Mol Cell Biol
|
1995-07-01 (15) |
7791755 |
The transcription factor associated Ccr4 and Caf1 proteins are components of the major cytoplasmic mRNA deadenylase in Saccharomyces cerevisiae. |
Tucker M, Valencia-Sanchez MA, Staples RR, Chen J, Denis CL, Parker R |
Cell
|
2001-01-09 (104) |
11239395 |
Molecular analysis of POP2 gene, a gene required for glucose-derepression of gene expression in Saccharomyces cerevisiae. |
Sakai A, Chibazakura T, Shimizu Y, Hishinuma F... |
Nucleic Acids Res
|
1992-12-11 (20) |
1475183 |
Yak1p, a DYRK family kinase, translocates to the nucleus and phosphorylates yeast Pop2p in response to a glucose signal. |
Moriya H, Shimizu-Yoshida Y, Omori A, Iwashita S, Katoh M, Sakai A... |
Genes Dev
|
2001-05-15 (15) |
11358866 |
X-ray structure and activity of the yeast Pop2 protein: a nuclease subunit of the mRNA deadenylase complex. |
Thore S, Mauxion F, Seraphin B, Suck D... |
EMBO Rep
|
2003-12-01 (4) |
14618157 |
Add your own comment!
There are no comments yet.
Last modification of this entry: 2012-11-22 15:26:23
Edited by a user: kaja
Edited content: Changed pfam, interpro, kegg and gene.
|