Welcome! Click here to login or here to register.
Home
Pathways
Proteins
Catalytic RNA molecules
Enzymatic complexes
Structures
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

ribonuclease III

 
FUNCTION:
pre-rRNA processing, pre-mRNA processing

REACTION:
pre-16S rRNA + H2O = mature 16S rRNA
pre-23S rRNA + H2O = mature 23S rRNA
pre-5S rRNA + H2O = mature 5S rRNA (PMID: 11586889)
pre-mRNA + H2O = mature mRNA(PMID: 12711683)

FAMILY:
Ribonuclease III class I

CELLULAR LOCALIZATION:
cytoplasm



Activities in which ribonuclease III is involved: Pathways in which ribonuclease III is involved:

NCBI GI number(s): 16130492
Species: Escherichia coli

Links to other databases:

Database ID Link
Uniprot P0A7Y0 P0A7Y0
BRENDA - -
KEGG - -
PFAM: - P0A7Y0 (Link - using uniprot id)
InterPro: - P0A7Y0 (Link - using uniprot id)
CATH: - -
SCOP: - -


Protein sequence:
MNPIVINRLQRKLGYTFNHQELLQQALTHRSASSKHNERLEFLGDSILSY
VIANALYHRFPRVDEGDMSRMRATLVRGNTLAELAREFELGECLRLGPGE
LKSGGFRRESILADTVEALIGGVFLDSDIQTVEKLILNWYQTRLDEISPG
DKQKDPKTRLQEYLQGRHLPLPTYLVVQVRGEAHDQEFTIHCQVSGLSEP
VVGTGSSRRKAEQAAAEQALKKLELE

Ribonuclease III (Escherichia coli) is product of expression of RNase III gene.

Ribonuclease III (Escherichia coli) belongs to following protein families:
References:

Title Authors Journal Publication date (Issue) PubMed ID
Mutational analysis of an RNA internal loop as a reactivity epitope for Escherichia coli ribonuclease III substrates. Calin-Jageman I, Nicholson AW Biochemistry 2003-05-06 (42) 12718545
RNA structure-dependent uncoupling of substrate recognition and cleavage by Escherichia coli ribonuclease III. Calin-Jageman I, Nicholson AW Nucleic Acids Res 2003-05-01 (31) 12711683
Crystallographic and modeling studies of RNase III suggest a mechanism for double-stranded RNA cleavage. Blaszczyk J, Tropea JE, Bubunenko M, Routzahn KM, Waugh DS, Court DL, Ji X Structure 2001-12-01 (9) 11738048
Escherichia coli ribonuclease III: affinity purification of hexahistidine-tagged enzyme and assays for substrate binding and cleavage. Amarasinghe AK, Calin-Jageman I, Harmouch A, Sun W, Nicholson AW Methods Enzymol 2001-01-01 (342) 11586889
DNA sequencing of the Escherichia coli ribonuclease III gene and its mutations. Nashimoto H, Uchida H Mol Gen Genet 1985-01-01 (201) 3903434
The complete genome sequence of Escherichia coli K-12. Blattner FR, Plunkett G 3rd, Bloch CA, Perna NT, Burland V, Riley M, Collado-Vides J, Glasner JD, Rode CK, Mayhew GF, Gregor J, Davis NW, Kirkpatrick HA, Goeden MA, Rose DJ, Mau B, Shao Y Science 1997-09-05 (277) 9278503
Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110. Hayashi K, Morooka N, Yamamoto Y, Fujita K, Isono K, Choi S, Ohtsubo E, Baba T, Wanner BL, Mori H, Horiuchi T Mol Syst Biol 2006-01-01 (2) 16738553
The DNA sequence of the gene (rnc) encoding ribonuclease III of Escherichia coli. March PE, Ahnn J, Inouye M Nucleic Acids Res 1985-07-11 (13) 3895158
Genetic analysis of the rnc operon of Escherichia coli. Takiff HE, Chen SM, Court DL J Bacteriol 1989-05-01 (171) 2540151
Expression and characterization of RNase III and Era proteins. Products of the rnc operon of Escherichia coli. Chen SM, Takiff HE, Barber AM, Dubois GC, Bardwell JC, Court DL J Biol Chem 1990-01-15 (265) 2105934
A GTP-binding protein of Escherichia coli has homology to yeast RAS proteins. Ahnn J, March PE, Takiff HE, Inouye M Proc Natl Acad Sci U S A 1986-12-01 (83) 3097637
Purification and properties of ribonuclease III from Escherichia coli. Robertson HD, Webster RE, Zinder ND J Biol Chem 1968-02-10 (243) 4865702
T7 early RNAs and Escherichia coli ribosomal RNAs are cut from large precursor RNAs in vivo by ribonuclease 3. Dunn JJ, Studier FW Proc Natl Acad Sci U S A 1973-12-01 (70) 4587248
Ribonuclease 3 does not degrade deoxyribonucleic acid-ribonucleic acid hybrids. Crouch RJ J Biol Chem 1974-01-25 (249) 4592261
30 S pre-ribosomal RNA of Escherichia coli and products of cleavage by ribonuclease III: length and molecular weight. Nikolaev N, Schlessinger D, Wellauer PK J Mol Biol 1974-07-15 (86) 4610145
RNase III cleavage of single-stranded RNA. Effect of ionic strength on the fideltiy of cleavage. Dunn JJ J Biol Chem 1976-06-25 (251) 932008
The synthesis of some proteins is affected in RNA processing mutants of Escherichia coli. Gitelman DR, Apirion D Biochem Biophys Res Commun 1980-10-16 (96) 6159890
RNase III cleavage is obligate for maturation but not for function of Escherichia coli pre-23S rRNA. King TC, Sirdeshmukh R, Schlessinger D Proc Natl Acad Sci U S A 1984-02-01 (81) 6364133
Cleavage by RNase III in the transcripts of the met Y-nus-A-infB operon of Escherichia coli releases the tRNA and initiates the decay of the downstream mRNA. Regnier P, Grunberg-Manago M J Mol Biol 1989-11-20 (210) 2481042
RNase III cleavages in non-coding leaders of Escherichia coli transcripts control mRNA stability and genetic expression. Regnier P, Grunberg-Manago M Biochimie 1990-11-01 (72) 2085545
The excision of intervening sequences from Salmonella 23S ribosomal RNA. Burgin AB, Parodos K, Lane DJ, Pace NR Cell 1990-01-09 (60) 2406020
Genetic uncoupling of the dsRNA-binding and RNA cleavage activities of the Escherichia coli endoribonuclease RNase III--the effect of dsRNA binding on gene expression. Dasgupta S, Fernandez L, Kameyama L, Inada T, Nakamura Y, Pappas A, Court DL Mol Microbiol 1998-05-01 (28) 9632264
Cell cycle arrest in Era GTPase mutants: a potential growth rate-regulated checkpoint in Escherichia coli. Britton RA, Powell BS, Dasgupta S, Sun Q, Margolin W, Lupski JR, Court DL Mol Microbiol 1998-01-01 (27) 9515700
Different cleavage specificities of RNases III from Rhodobacter capsulatus and Escherichia coli. Conrad C, Rauhut R, Klug G Nucleic Acids Res 1998-10-01 (26) 9742248
Mechanism of action of Escherichia coli ribonuclease III. Stringent chemical requirement for the glutamic acid 117 side chain and Mn2+ rescue of the Glu117Asp mutant. Sun W, Nicholson AW Biochemistry 2001-04-24 (40) 11305928
Functional interaction between RNase III and the Escherichia coli ribosome. Allas U, Liiv A, Remme J BMC Mol Biol 2003-06-18 (4) 12814522
Mutational analysis of the nuclease domain of Escherichia coli ribonuclease III. Identification of conserved acidic residues that are important for catalytic function in vitro. Sun W, Li G, Nicholson AW Biochemistry 2004-10-19 (43) 15476399
Catalytic mechanism of Escherichia coli ribonuclease III: kinetic and inhibitor evidence for the involvement of two magnesium ions in RNA phosphodiester hydrolysis. Sun W, Pertzev A, Nicholson AW Nucleic Acids Res 2005-01-01 (33) 15699182
YmdB: a stress-responsive ribonuclease-binding regulator of E. coli RNase III activity. Kim KS, Manasherob R, Cohen SN Genes Dev 2008-12-15 (22) 19141481
Structure of the dsRNA binding domain of E. coli RNase III. Kharrat A, Macias MJ, Gibson TJ, Nilges M, Pastore A EMBO J 1995-07-17 (14) 7628457



Add your own comment!


There are no comments yet.

Last modification of this entry: 2012-07-05 14:52:32
Edited by a user: kaja
Edited content: Changed publications.

Welcome stranger! Click here to login or here to register.