Welcome! Click here to login or here to register.
Home
Pathways
Proteins
Catalytic RNA molecules
Enzymatic complexes
Structures
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

ribonuclease I

 
Known also as: Enterobacter ribonuclease

Known abbreviations: rna, rnsA

REACTION:
Two-stage endonucleolytic cleavage to nucleoside 3'-phosphates and 3'-phosphooligonucleotides with 2',3'-cyclic phosphate intermediates.

CELLULAR LOCALIZATION:
periplasm, rybosome



Activities in which ribonuclease I is involved: Pathways in which ribonuclease I is involved:

NCBI GI number(s): 1786828
Species: Escherichia coli

Links to other databases:

Database ID Link
Uniprot P21338 P21338
BRENDA - -
KEGG eco:b0611 eco:b0611
PFAM: PF00445
PF00445
InterPro: IPR001568
IPR001568
CATH: - -
SCOP: - -
Solved crystal structures: 2EA1
2PQX
2PQY
2Z70
[PDB] [details]
[PDB] [details]
[PDB] [details]
[PDB] [details]


Protein sequence:
MKAFWRNAALLAVSLLPFSSANALALQAKQYGDFDRYVLALSWQTGFCQS
QHDRNRNERDECRLQTETTNKADFLTVHGLWPGLPKSVAARGVDERRWMR
FGCATRPIPNLPEARASRMCSSPETGLSLETAAKLSEVMPGAGGRSCLER
YEYAKHGACFGFDPDAYFGTMVRLNQEIKESEAGKFLADNYGKTVSRRDF
DAAFAKSWGKENVKAVKLTCQGNPAYLTEIQISIKADAINAPLSANSFLP
QPHPGNCGKTFVIDKAGY

Ribonuclease I (Escherichia coli) is product of expression of ribonuclease I gene.

Ribonuclease I (Escherichia coli) belongs to following protein families:
References:

Title Authors Journal Publication date (Issue) PubMed ID
The complete genome sequence of Escherichia coli K-12. Blattner FR, Plunkett G 3rd, Bloch CA, Perna NT, Burland V, Riley M, Collado-Vides J, Glasner JD, Rode CK, Mayhew GF, Gregor J, Davis NW, Kirkpatrick HA, Goeden MA, Rose DJ, Mau B, Shao Y Science 1997-09-05 (277) 9278503
Cloning and sequencing the gene encoding Escherichia coli ribonuclease I: exact physical mapping using the genome library. Meador J 3rd, Kennell D Gene 1990-10-01 (95) 2253883
Protein family classification based on searching a database of blocks. Henikoff S, Henikoff JG Genomics 1994-02-01 (19) 8188249
Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110. Hayashi K, Morooka N, Yamamoto Y, Fujita K, Isono K, Choi S, Ohtsubo E, Baba T, Wanner BL, Mori H, Horiuchi T Mol Syst Biol 2006-01-01 (2) 16738553
A 718-kb DNA sequence of the Escherichia coli K-12 genome corresponding to the 12.7-28.0 min region on the linkage map. Oshima T, Aiba H, Baba T, Fujita K, Hayashi K, Honjo A, Ikemoto K, Inada T, Itoh T, Kajihara M, Kanai K, Kashimoto K, Kimura S, Kitagawa M, Makino K, Masuda S, Miki T, Mizobuchi K, Mori H, Motomura K, Nakamura Y, Nashimoto H, Nishio Y, Saito N, Horiuchi T, et al. DNA Res 1996-06-01 (3) 8905232



Add your own comment!


There are no comments yet.

Last modification of this entry: Sept. 25, 2012.

Welcome stranger! Click here to login or here to register.