Welcome! Click here to login or here to register.
Home
Pathways
Proteins
Catalytic RNA molecules
Enzymatic complexes
Structures
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

Ribonuclease PH

 
Known also as: tRNA nucleotidyltransferase

Known abbreviations: RNase PH

FUNCTION:
Phosphorolytic exoribonuclease that removes nucleotide residues following the -CCA terminus of tRNA and adds nucleotides to the ends of RNA molecules by using nucleoside diphosphates as substrates.

The gene in K12 strains MG1655 and W3110 (and also other derivatives of K12 W1485) has a frameshift mutation that leads to loss of activity, although the protein may be translated. Thus in those strains rph is an expressed but non-functional pseudogene. Strains shown in this entry are derivatives of K12 MC1000 or MC4100, in which the frameshift has not occured and thus are active.

REACTION:
tRNA(n+1) + phosphate = tRNA(n) + a nucleoside diphosphate (BRENDA)

CELLULAR LOCALIZATION:
cytoplasm

SUBUNIT:
Homodimer (Probable).



Activities in which Ribonuclease PH is involved: Pathways in which Ribonuclease PH is involved:

NCBI GI number(s): -
Species: Escherichia coli

Links to other databases:

Database ID Link
Uniprot P0CG18 P0CG18
BRENDA - -
KEGG - -
PFAM: - P0CG18 (Link - using uniprot id)
InterPro: - P0CG18 (Link - using uniprot id)
CATH: - -
SCOP: - -


Protein sequence:
MRPAGRSNNQVRPVTLTRNYTKHAEGSVLVEFGDTKVLCTASIEEGVPRF
LKGQGQGWITAEYGMLPRSTHTRNAREAAKGKQGGRTMEIQRLIARALRA
AVDLKALGEFTITLDCDVLQADGGTRTASITGACVALVDALQKLVENGKL
KTNPMKGMVAAVSVGIVNGEAVCDLEYVEDSAAETDMNVVMTEDGRIIEV
QGTAEGEPFTHEELLILLALARGGIESIVATQKAALAN

Ribonuclease PH (Escherichia coli) is product of expression of ribonuclease PH gene.

Ribonuclease PH (Escherichia coli) belongs to following protein families:
References:

Title Authors Journal Publication date (Issue) PubMed ID
Characterization of Escherichia coli RNase PH. Kelly KO, Deutscher MP J Biol Chem 1992-08-25 (267) 1512253
RNase PH: an Escherichia coli phosphate-dependent nuclease distinct from polynucleotide phosphorylase. Deutscher MP, Marshall GT, Cudny H Proc Natl Acad Sci U S A 1988-07-01 (85) 2455297
3' processing of tRNA precursors in ribonuclease-deficient Escherichia coli. Development and characterization of an in vitro processing system and evidence for a phosphate requirement. Cudny H, Deutscher MP J Biol Chem 1988-02-25 (263) 3275667
Genomic sequencing reveals regulatory mutations and recombinational events in the widely used MC4100 lineage of Escherichia coli K-12. Ferenci T, Zhou Z, Betteridge T, Ren Y, Liu Y, Feng L, Reeves PR, Wang L J Bacteriol 2009-06-01 (191) 19376874
Structure of the Escherichia coli pyrE operon and control of pyrE expression by a UTP modulated intercistronic attentuation. Poulsen P, Bonekamp F, Jensen KF EMBO J 1984-08-01 (3) 6207018
Escherichia coli orfE (upstream of pyrE) encodes RNase PH. Ost KA, Deutscher MP J Bacteriol 1991-09-01 (173) 1885537
Three genes preceding pyrE on the Escherichia coli chromosome are essential for survival and normal cell morphology in stationary culture and at high temperature. Poulsen P, Jensen KF Res Microbiol 1991-01-01 (142) 1925027
Overexpression and rapid purification of the orfE/rph gene product, RNase PH of Escherichia coli. Jensen KF, Andersen JT, Poulsen P J Biol Chem 1992-08-25 (267) 1512252



Add your own comment!


There are no comments yet.

Last modification of this entry: Sept. 25, 2012.

Welcome stranger! Click here to login or here to register.