Welcome! Click here to login or here to register.
Home
Pathways
Proteins
Catalytic RNA molecules
Enzymatic complexes
Structures
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

Exoribonuclease 2

 
Known also as: Ribonuclease II

Known abbreviations: RNase II

FUNCTION:
Involved in mRNA degradation. Hydrolyzes single-stranded polyribonucleotides processively in the 3' to 5' direction.

REACTION:
precursor tRNA + H2O = mature tRNA + 5'-phosphomononucleotides
poly(A) + H2O = 5'-AMP + oligonucleotide
ssRNA + H2O = 5'-phosphomononucleotides (3' to 5'direction only)

CATALYTIC ACTIVITY:
Exonucleolytic cleavage in the 3'- to 5'-direction to yield nucleoside 5'-phosphates.

COFACTOR:
Magnesium.

ENZYME REGULATION:
Stimulated by the presence of a monovalent cation.


BIOPHYSICOCHEMICAL PROPERTIES:

Kinetic parameters:


  • Vmax=109800 nmol/min/mg enzyme with Poly(A) as substrate;
  • Vmax=160 nmol/min/mg enzyme with 23S rRNA as substrate;
  • Vmax=30 nmol/min/mg enzyme with 16S rRNA as substrate;
  • Vmax=20 nmol/min/mg enzyme with 5S rRNA assubstrate;

pH dependence: Optimum pH is 7.5-9.5;

Temperature dependence: Optimum temperature is 50 degrees Celsius.

CELLULAR LOCALIZATION:
cytoplasm, ribosome
 




Activities in which Exoribonuclease 2 is involved: Pathways in which Exoribonuclease 2 is involved:

NCBI GI number(s): 2507333
Species: Escherichia coli

Links to other databases:

Database ID Link
Uniprot P30850 P30850
BRENDA - -
KEGG - -
PFAM: - P30850 (Link - using uniprot id)
InterPro: - P30850 (Link - using uniprot id)
CATH: - -
SCOP: - -
Solved crystal structures: 2IX1
2IX0
2ID0
[PDB] [details]
[PDB] [details]
[PDB] [details]


Protein sequence:
MFQDNPLLAQLKQQLHSQTPRAEGVVKATEKGFGFLEVDAQKSYFIPPPQ
MKKVMHGDRIIAVIHSEKERESAEPEELVEPFLTRFVGKVQGKNDRLAIV
PDHPLLKDAIPCRAARGLNHEFKEGDWAVAEMRRHPLKGDRSFYAELTQY
ITFGDDHFVPWWVTLARHNLEKEAPDGVATEMLDEGLVREDLTALDFVTI
DSASTEDMDDALFAKALPDDKLQLIVAIADPTAWIAEGSKLDKAAKIRAF
TNYLPGFNIPMLPRELSDDLCSLRANEVRPVLACRMTLSADGTIEDNIEF
FAATIESKAKLVYDQVSDWLENTGDWQPESEAIAEQVRLLAQICQRRGEW
RHNHALVFKDRPDYRFILGEKGEVLDIVAEPRRIANRIVEEAMIAANICA
ARVLRDKLGFGIYNVHMGFDPANADALAALLKTHGLHVDAEEVLTLDGFC
KLRRELDAQPTGFLDSRIRRFQSFAEISTEPGPHFGLGLEAYATWTSPIR
KYGDMINHRLLKAVIKGETATRPQDEITVQMAERRRLNRMAERDVGDWLY
ARFLKDKAGTDTRFAAEIVDISRGGMRVRLVDNGAIAFIPAPFLHAVRDE
LVCSQENGTVQIKGETVYKVTDVIDVTIAEVRMETRSIIARPVA

Exoribonuclease 2 (Escherichia coli) is product of expression of rnb gene.

Exoribonuclease 2 (Escherichia coli) belongs to following protein families:
References:

Title Authors Journal Publication date (Issue) PubMed ID
Action of RNase II and polynucleotide phosphorylase against RNAs containing stem-loops of defined structure. Spickler C, Mackie GA J Bacteriol 2000-05-01 (182) 10762241
PURIFICATION AND PROPERTIES OF RIBONUCLEASE II FROM ESCHERICHIA COLI. SPAHR PF J Biol Chem 1964-11-01 (239) 14257598
Escherichia coli ribonuclease II. Cannistraro VJ, Kennell D Methods Enzymol 2001-01-01 (342) 11586905
The complete genome sequence of Escherichia coli K-12. Blattner FR, Plunkett G 3rd, Bloch CA, Perna NT, Burland V, Riley M, Collado-Vides J, Glasner JD, Rode CK, Mayhew GF, Gregor J, Davis NW, Kirkpatrick HA, Goeden MA, Rose DJ, Mau B, Shao Y Science 1997-09-05 (277) 9278503
A 570-kb DNA sequence of the Escherichia coli K-12 genome corresponding to the 28.0-40.1 min region on the linkage map. Aiba H, Baba T, Hayashi K, Inada T, Isono K, Itoh T, Kasai H, Kashimoto K, Kimura S, Kitakawa M, Kitagawa M, Makino K, Miki T, Mizobuchi K, Mori H, Mori T, Motomura K, Nakade S, Nakamura Y, Nashimoto H, Nishio Y, Oshima T, Saito N, Sampei G, Horiuchi T, et al. DNA Res 1996-12-31 (3) 9097039
Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110. Hayashi K, Morooka N, Yamamoto Y, Fujita K, Isono K, Choi S, Ohtsubo E, Baba T, Wanner BL, Mori H, Horiuchi T Mol Syst Biol 2006-01-01 (2) 16738553
DNA sequencing and expression of the gene rnb encoding Escherichia coli ribonuclease II. Zilhao R, Camelo L, Arraiano CM Mol Microbiol 1993-04-01 (8) 8497196
Purification and characterization of the Escherichia coli exoribonuclease RNase R. Comparison with RNase II. Cheng ZF, Deutscher MP J Biol Chem 2002-06-14 (277) 11948193



Add your own comment!


There are no comments yet.

Last modification of this entry: Sept. 25, 2012.

Welcome stranger! Click here to login or here to register.