|
Known also as: RNA exonuclease 2 homolog, Small fragment nuclease
Known abbreviations: REXO2, SFN, SMFN, CGI-114
FUNCTION:
3'-to-5' exoribonuclease specific for small oligoribonucleotides. Active on small (primarily 5 nucleotides in length) single-stranded RNA and DNA oligomers. May have a role for cellular nucleotide recycling.
SUBUNIT STRUCTURE:
Homotetramer (Probable).
CELLULAR LOCALIZATION:
Isoform 1: Mitochondrion.
Isoform 2: Nucleus.
COFACTOR:
Manganese.
|
Links to other databases:
Protein sequence:
MLGGSLGSRLLRGVGGSHGRFGARGVREGGAAMAAGESMAQRMVWVDLEM
TGLDIEKDQIIEMACLITDSDLNILAEGPNLIIKQPDELLDSMSDWCKEH
HGKSGLTKAVKESTITLQQAEYEFLSFVRQQTPPGLCPLAGNSVHEDKKF
LDKYMPQFMKHLHYRIIDVSTVKELCRRWYPEEYEFAPKKAASHRALDDI
SESIKELQFYRNNIFKKKIDEKKRKIIENGENEKTVS
|
Oligoribonuclease, mitochondrial (Homo sapiens) is product of expression of
REXO2
gene.
Oligoribonuclease, mitochondrial (Homo sapiens) belongs to following protein families:
References:
Title |
Authors |
Journal
| Publication date (Issue)
| PubMed ID
|
Hydrolysis of the 5'-p-nitrophenyl ester of TMP by oligoribonucleases (ORN) from Escherichia coli, Mycobacterium smegmatis, and human. |
Young Park A, Elvin CM, Hamdan SM, Wood RJ, Liyou NE, Hamwood TE, Jennings PA, Dixon NE |
Protein Expr Purif
|
2008-01-01 (57) |
18023590 |
The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). |
Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, K |
Genome Res
|
2004-10-01 (14) |
15489334 |
The human homolog of Escherichia coli Orn degrades small single-stranded RNA and DNA oligomers. |
Nguyen LH, Erzberger JP, Root J, Wilson DM 3rd |
J Biol Chem
|
2000-08-25 (275) |
10851236 |
Initial characterization of the human central proteome. |
Burkard TR, Planyavsky M, Kaupe I, Breitwieser FP, Burckstummer T, Bennett KL, Superti-Furga G, Colinge J |
BMC Syst Biol
|
2011-01-01 (5) |
21269460 |
Identification of novel human genes evolutionarily conserved in Caenorhabditis elegans by comparative proteomics. |
Lai CH, Chou CY, Ch'ang LY, Liu CS, Lin W |
Genome Res
|
2000-05-01 (10) |
10810093 |
Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs. |
Wiemann S, Weil B, Wellenreuther R, Gassenhuber J, Glassl S, Ansorge W, Bocher M, Blocker H, Bauersachs S, Blum H, Lauber J, Dusterhoft A, Beyer A, Kohrer K, Strack N, Mewes HW, Ottenwalder B, Obermaier B, Tampe J, Heubner D, Wambutt R, Korn B, Klein M, Poustka A |
Genome Res
|
2001-03-01 (11) |
11230166 |
Immunoaffinity profiling of tyrosine phosphorylation in cancer cells. |
Rush J, Moritz A, Lee KA, Guo A, Goss VL, Spek EJ, Zhang H, Zha XM, Polakiewicz RD, Comb MJ |
Nat Biotechnol
|
2005-02-01 (23) |
15592455 |
Global survey of phosphotyrosine signaling identifies oncogenic kinases in lung cancer. |
Rikova K, Guo A, Zeng Q, Possemato A, Yu J, Haack H, Nardone J, Lee K, Reeves C, Li Y, Hu Y, Tan Z, Stokes M, Sullivan L, Mitchell J, Wetzel R, Macneill J, Ren JM, Yuan J, Bakalarski CE, Villen J, Kornhauser JM, Smith B, Li D, Zhou X, Gygi SP, Gu TL, Polakiewicz RD, Rush J, Comb MJ |
Cell
|
2007-12-14 (131) |
18083107 |
Add your own comment!
There are no comments yet.
Last modification of this entry: Sept. 25, 2012.
|