Welcome! Click here to login or here to register.
Home
Pathways
Proteins
Catalytic RNA molecules
Enzymatic complexes
Structures
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

Oligoribonuclease, mitochondrial
 
Known also as: RNA exonuclease 2 homolog, Small fragment nuclease

Known abbreviations: REXO2, SFN, SMFN, CGI-114

FUNCTION:

3'-to-5' exoribonuclease specific for small oligoribonucleotides. Active on small (primarily 5 nucleotides in length) single-stranded RNA and DNA oligomers. May have a role for cellular nucleotide recycling.

SUBUNIT STRUCTURE:

Homotetramer (Probable).

CELLULAR LOCALIZATION:

Isoform 1: Mitochondrion.
Isoform 2: Nucleus.

COFACTOR:

Manganese.


NCBI GI number(s): 224496106
Species: Homo sapiens

Links to other databases:

Database ID Link
Uniprot Q9Y3B8 Q9Y3B8
BRENDA - -
KEGG hsa:25996 hsa:25996
PFAM: - Q9Y3B8 (Link - using uniprot id)
InterPro: - Q9Y3B8 (Link - using uniprot id)
CATH: - -
SCOP: - -


Protein sequence:
MLGGSLGSRLLRGVGGSHGRFGARGVREGGAAMAAGESMAQRMVWVDLEM
TGLDIEKDQIIEMACLITDSDLNILAEGPNLIIKQPDELLDSMSDWCKEH
HGKSGLTKAVKESTITLQQAEYEFLSFVRQQTPPGLCPLAGNSVHEDKKF
LDKYMPQFMKHLHYRIIDVSTVKELCRRWYPEEYEFAPKKAASHRALDDI
SESIKELQFYRNNIFKKKIDEKKRKIIENGENEKTVS

Oligoribonuclease, mitochondrial (Homo sapiens) is product of expression of REXO2 gene.

Oligoribonuclease, mitochondrial (Homo sapiens) belongs to following protein families:
References:

Title Authors Journal Publication date (Issue) PubMed ID
Hydrolysis of the 5'-p-nitrophenyl ester of TMP by oligoribonucleases (ORN) from Escherichia coli, Mycobacterium smegmatis, and human. Young Park A, Elvin CM, Hamdan SM, Wood RJ, Liyou NE, Hamwood TE, Jennings PA, Dixon NE Protein Expr Purif 2008-01-01 (57) 18023590
The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, K Genome Res 2004-10-01 (14) 15489334
The human homolog of Escherichia coli Orn degrades small single-stranded RNA and DNA oligomers. Nguyen LH, Erzberger JP, Root J, Wilson DM 3rd J Biol Chem 2000-08-25 (275) 10851236
Initial characterization of the human central proteome. Burkard TR, Planyavsky M, Kaupe I, Breitwieser FP, Burckstummer T, Bennett KL, Superti-Furga G, Colinge J BMC Syst Biol 2011-01-01 (5) 21269460
Identification of novel human genes evolutionarily conserved in Caenorhabditis elegans by comparative proteomics. Lai CH, Chou CY, Ch'ang LY, Liu CS, Lin W Genome Res 2000-05-01 (10) 10810093
Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs. Wiemann S, Weil B, Wellenreuther R, Gassenhuber J, Glassl S, Ansorge W, Bocher M, Blocker H, Bauersachs S, Blum H, Lauber J, Dusterhoft A, Beyer A, Kohrer K, Strack N, Mewes HW, Ottenwalder B, Obermaier B, Tampe J, Heubner D, Wambutt R, Korn B, Klein M, Poustka A Genome Res 2001-03-01 (11) 11230166
Immunoaffinity profiling of tyrosine phosphorylation in cancer cells. Rush J, Moritz A, Lee KA, Guo A, Goss VL, Spek EJ, Zhang H, Zha XM, Polakiewicz RD, Comb MJ Nat Biotechnol 2005-02-01 (23) 15592455
Global survey of phosphotyrosine signaling identifies oncogenic kinases in lung cancer. Rikova K, Guo A, Zeng Q, Possemato A, Yu J, Haack H, Nardone J, Lee K, Reeves C, Li Y, Hu Y, Tan Z, Stokes M, Sullivan L, Mitchell J, Wetzel R, Macneill J, Ren JM, Yuan J, Bakalarski CE, Villen J, Kornhauser JM, Smith B, Li D, Zhou X, Gygi SP, Gu TL, Polakiewicz RD, Rush J, Comb MJ Cell 2007-12-14 (131) 18083107


Add your own comment!


There are no comments yet.

Last modification of this entry: Sept. 25, 2012.
Welcome stranger! Click here to login or here to register.