Welcome! Click here to login or here to register.
Home
Pathways
Proteins
Catalytic RNA molecules
Enzymatic complexes
Structures
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

Exosome complex exonuclease RRP6

 
Known also as: Ribosomal RNA-processing protein 6

Known abbreviations: Rrp6, UNC733, YOR001W

FUNCTION:
  • exosome component with exonuclease activity (PMID: 10611239, 17942686)
  • processing of polycistronic pre-snoRNAs (participation in generation of individual transcripts from polycistronic RNAs )(PMID: 10508172, 10611222)
  • interactions with the mRNA polyadenylation apparatus and degradation unadenylated mRNAs (PMID: 10611239)
  • participation in trimming of the last few nucleotides from the 3' end of many structured RNA substrates (PMID: 17942686, 10611239)
  • Required for degradation of 3'-end of the 7S pre-RNA to generate mature 5.8S (S) rRNA and 5.8S(L) rRNA (cleavage at site C2 in 3'-5' direction) (PMID:10508172)
  • processing of U4 snRNA (PMID: 10611222)

CELLULAR LOCALIZATION:

nucleus (PMID: 15145828, 10611222)

SUBUNIT STRUCTURE:

The exosome multienzyme ribonuclease complex is composed of 10 core proteins: the ring-forming non-catalytic subunits CSL4, MTR3, RRP4, RRP40, RRP42, RRP43, RRP45, RRP46 and SKI6/RRP41, and the catalytic subunit DIS3/RRP44. In the nucleus, RRP6 interacts with at least exosome core proteins and LRP1. Interacts with NPL3, NOP53 and PAP1.




This protein can be a part of a given complexes: Activities in which Exosome complex exonuclease RRP6 is involved: Pathways in which Exosome complex exonuclease RRP6 is involved:

NCBI GI number(s): 14195186
Species: Saccharomyces cerevisiae

Links to other databases:

Database ID Link
Uniprot Q12149 Q12149
BRENDA - -
KEGG sce:YOR001W sce:YOR001W
PFAM: PF01612
PF00570
PF08066
PF01612
PF00570
PF08066
InterPro: IPR002562
IPR012588
IPR002121
IPR010997
IPR012337
IPR002562
IPR012588
IPR002121
IPR010997
IPR012337
CATH: - -
SCOP: - -
Solved crystal structures: 1M0Y
2HBJ
2HBK
2HBL
2HBM
[PDB] [details]
[PDB] [details]
[PDB] [details]
[PDB] [details]
[PDB] [details]


Protein sequence:
MTSENPDVLLSRVINVVRAASSLASQDVDFYKNLDRGFSKDLKSKADKLA
DMANEIILSIDEHHESFELKEEDISDLWNNFGNIMDNLLEMSDHSLDKLN
CAINSKSRGSDLQYLGEFSGKNFSPTKRVEKPQLKFKSPIDNSESHPFIP
LLKEKPNALKPLSESLRLVDDDENNPSHYPHPYEYEIDHQEYSPEILQIR
EEIPSKSWDDSVPIWVDTSTELESMLEDLKNTKEIAVDLEHHDYRSYYGI
VCLMQISTRERDYLVDTLKLRENLHILNEVFTNPSIVKVFHGAFMDIIWL
QRDLGLYVVGLFDTYHASKAIGLPRHSLAYLLENFANFKTSKKYQLADWR
IRPLSKPMTAYARADTHFLLNIYDQLRNKLIESNKLAGVLYESRNVAKRR
FEYSKYRPLTPSSEVYSPIEKESPWKILMYQYNIPPEREVLVRELYQWRD
LIARRDDESPRFVMPNQLLAALVAYTPTDVIGVVSLTNGVTEHVRQNAKL
LANLIRDALRNIKNTNEEATPIPSSETKADGILLETISVPQIRDVMERFS
VLCNSNISKSRAKPVTNSSILLGKILPREEHDIAYSKDGLPNKVKTEDIR
IRAQNFKSALANLEDIIFEIEKPLVVPVKLEEIKTVDPASAPNHSPEIDN
LDDLVVLKKKNIQKKQPAKEKGVTEKDAVDYSKIPNILSNKPGQNNRQQK
KRRFDPSSSDSNGPRAAKKRRPAAKGKNLSFKR

Exosome complex exonuclease RRP6 (Saccharomyces cerevisiae) is product of expression of RRP6 gene.

Exosome complex exonuclease RRP6 (Saccharomyces cerevisiae) belongs to following protein families:
References:

Title Authors Journal Publication date (Issue) PubMed ID
Functions of the exosome in rRNA, snoRNA and snRNA synthesis. Allmang C, Kufel J, Chanfreau G, Mitchell P, Petfalski E, Tollervey D EMBO J 1999-10-01 (18) 10508172
Reconstitution, activities, and structure of the eukaryotic RNA exosome. Liu Q, Greimann JC, Lima CD Cell 2006-12-15 (127) 17174896
Global analysis of protein localization in budding yeast. Huh WK, Falvo JV, Gerke LC, Carroll AS, Howson RW, Weissman JS, O'Shea EK Nature 2003-10-16 (425) 14562095
The yeast exosome and human PM-Scl are related complexes of 3' --> 5' exonucleases. Allmang C, Petfalski E, Podtelejnikov A, Mann M, Tollervey D, Mitchell P Genes Dev 1999-08-15 (13) 10465791
Yeast exosome mutants accumulate 3'-extended polyadenylated forms of U4 small nuclear RNA and small nucleolar RNAs. van Hoof A, Lennertz P, Parker R Mol Cell Biol 2000-02-01 (20) 10611222
Architecture of the yeast Rrp44 exosome complex suggests routes of RNA recruitment for 3' end processing. Wang HW, Wang J, Ding F, Callahan K, Bratkowski MA, Butler JS, Nogales E, Ke A Proc Natl Acad Sci U S A 2007-10-23 (104) 17942686
Nuclear surveillance and degradation of hypomodified initiator tRNAMet in S. cerevisiae. Kadaba S, Krueger A, Trice T, Krecic AM, Hinnebusch AG, Anderson J Genes Dev 2004-06-01 (18) 15145828
A nuclear 3'-5' exonuclease involved in mRNA degradation interacts with Poly(A) polymerase and the hnRNA protein Npl3p. Burkard KT, Butler JS Mol Cell Biol 2000-02-01 (20) 10611239
The nucleotide sequence of Saccharomyces cerevisiae chromosome XV. Dujon B, Albermann K, Aldea M, Alexandraki D, Ansorge W, Arino J, Benes V, Bohn C, Bolotin-Fukuhara M, Bordonne R, Boyer J, Camasses A, Casamayor A, Casas C, Cheret G, Cziepluch C, Daignan-Fornier B, Dang DV, de Haan M, Delius H, Durand P, Fairhead C, Feldmann H, Gaillon L, Kleine K, et al. Nature 1997-05-01 (387) 9169874
A single subunit, Dis3, is essentially responsible for yeast exosome core activity. Dziembowski A, Lorentzen E, Conti E, Seraphin B Nat Struct Mol Biol 2007-02-01 (14) 17173052
Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae. Hu Y, Rolfs A, Bhullar B, Murthy TV, Zhu C, Berger MF, Camargo AA, Kelley F, McCarron S, Jepson D, Richardson A, Raphael J, Moreira D, Taycher E, Zuo D, Mohr S, Kane MF, Williamson J, Simpson A, Bulyk ML, Harlow E, Marsischky G, Kolodner RD, LaBaer J Genome Res 2007-04-01 (17) 17322287
Global analysis of protein expression in yeast. Ghaemmaghami S, Huh WK, Bower K, Howson RW, Belle A, Dephoure N, O'Shea EK, Weissman JS Nature 2003-10-16 (425) 14562106
Large-scale phosphorylation analysis of alpha-factor-arrested Saccharomyces cerevisiae. Li X, Gerber SA, Rudner AD, Beausoleil SA, Haas W, Villen J, Elias JE, Gygi SP J Proteome Res 2007-03-01 (6) 17330950
A multidimensional chromatography technology for in-depth phosphoproteome analysis. Albuquerque CP, Smolka MB, Payne SH, Bafna V, Eng J, Zhou H Mol Cell Proteomics 2008-07-01 (7) 18407956
Proteome-wide identification of in vivo targets of DNA damage checkpoint kinases. Smolka MB, Albuquerque CP, Chen SH, Zhou H Proc Natl Acad Sci U S A 2007-06-19 (104) 17563356
Rrp47p is an exosome-associated protein required for the 3' processing of stable RNAs. Mitchell P, Petfalski E, Houalla R, Podtelejnikov A, Mann M, Tollervey D Mol Cell Biol 2003-10-01 (23) 12972615
The sequence of a 30 kb fragment on the left arm of chromosome XV from Saccharomyces cerevisiae reveals 15 open reading frames, five of which correspond to previously identified genes. Sterky F, Holmberg A, Pettersson B, Uhlen M Yeast 1996-09-01 (12) 8896276
Rrp6p, the yeast homologue of the human PM-Scl 100-kDa autoantigen, is essential for efficient 5.8 S rRNA 3' end formation. Briggs MW, Burkard KT, Butler JS J Biol Chem 1998-05-22 (273) 9582370
Genome-wide mRNA surveillance is coupled to mRNA export. Hieronymus H, Yu MC, Silver PA Genes Dev 2004-11-01 (18) 15489286
Nop53p interacts with 5.8S rRNA co-transcriptionally, and regulates processing of pre-rRNA by the exosome. Granato DC, Machado-Santelli GM, Oliveira CC FEBS J 2008-08-01 (275) 18631361



Add your own comment!


There are no comments yet.

Last modification of this entry: 2010-04-12 22:29:09
Edited by a user: kaja
Edited content: Changed uniprot.

Welcome stranger! Click here to login or here to register.