Welcome! Click here to login or here to register.
Home
Pathways
Proteins
Catalytic RNA molecules
Enzymatic complexes
Structures
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

Ribonuclease P protein subunit p20

 
Known abbreviations: Rpp20, POP7

FUNCTION:

Component of ribonuclease P, a protein complex that generates mature tRNA molecules by cleaving their 5'-ends.

CATALYTIC ACTIVITY:

Endonucleolytic cleavage of RNA, removing 5'-extranucleotides from tRNA precursor.

SUBUNIT STRUCTURE:

Component of nuclear RNase P and RNase MRP ribonucleoproteins. RNase P consists of a RNA moiety and at least 8 protein subunits; POP1, RPP14, RPP20/POP7, RPP25, RPP29/POP4, RPP30, RPP38 and RPP40. RNase MRP consists of a RNA moiety and at least 9 protein subunits; POP1, RPP14, RPP20/POP7, RPP25, RPP29/POP4, RPP30, RPP38, RPP40, POP5 and RPP21. Interacts with RPP25. RPP20/POP7 is probably a dimer.

CELLULAR LOCALIZATION:

Nucleus › nucleolus (Potential).



This protein can be a part of a given complexes: Activities in which Ribonuclease P protein subunit p20 is involved: Pathways in which Ribonuclease P protein subunit p20 is involved:

NCBI GI number(s): 153791431
153791430
Species: Homo sapiens

Links to other databases:

Database ID Link
Uniprot O75817 O75817
BRENDA - -
KEGG hsa:10248 hsa:10248
PFAM: - O75817 (Link - using uniprot id)
InterPro: IPR014612
IPR014612
CATH: - -
SCOP: - -


Protein sequence:
MAENREPRGAVEAELDPVEYTLRKRLPSRLPRRPNDIYVNMKTDFKAQLA
RCQKLLDGGARGQNACSEIYIHGLGLAINRAINIALQLQAGSFGSLQVAA
NTSTVELVDELEPETDTREPLTRIRNNSAIHIRVFRVTPK

Ribonuclease P protein subunit p20 (Homo sapiens) is product of expression of POP7 gene.

Ribonuclease P protein subunit p20 (Homo sapiens) belongs to following protein families:
References:

Title Authors Journal Publication date (Issue) PubMed ID
The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, K Genome Res 2004-10-01 (14) 15489334
Mutual interactions between subunits of the human RNase MRP ribonucleoprotein complex. Welting TJ, van Venrooij WJ, Pruijn GJ Nucleic Acids Res 2004-01-01 (32) 15096576
Autoantigenic properties of some protein subunits of catalytically active complexes of human ribonuclease P. Jarrous N, Eder PS, Guerrier-Takada C, Hoog C, Altman S RNA 1998-04-01 (4) 9630247
Initial characterization of the human central proteome. Burkard TR, Planyavsky M, Kaupe I, Breitwieser FP, Burckstummer T, Bennett KL, Superti-Furga G, Colinge J BMC Syst Biol 2011-01-01 (5) 21269460
Human chromosome 7: DNA sequence and biology. Scherer SW, Cheung J, MacDonald JR, Osborne LR, Nakabayashi K, Herbrick JA, Carson AR, Parker-Katiraee L, Skaug J, Khaja R Science 2003-05-02 (300) 12690205



Add your own comment!


There are no comments yet.

Last modification of this entry: 2012-04-04 10:36:57
Edited by a user: kaja
Edited content: Changed interacting_proteins.

Welcome stranger! Click here to login or here to register.