Welcome! Click here to login or here to register.
Home
Pathways
Proteins
Catalytic RNA molecules
Enzymatic complexes
Structures
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

Ribonuclease P protein subunit p21

 
Known also as: Ribonuclease P/MRP 21 kDa subunit, Ribonucleoprotein V

Known abbreviations: Rpp21, C6orf135, CAT60

FUNCTION:

Component of ribonuclease P, a protein complex that generates mature tRNA molecules by cleaving their 5'-ends. CATALYTIC ACTIVITY:

Endonucleolytic cleavage of RNA, removing 5'-extranucleotides from tRNA precursor. SUBUNIT STRUCTURE:

RNase P consists of a RNA moiety and at least 9 protein subunits; POP1, RPP14, RPP20/POP7, RPP21, RPP25, RPP29/POP4, RPP30, RPP38 and RPP40.

CELLULAR LOCALIZATION:

Nucleus › nucleolus.



This protein can be a part of a given complexes: Activities in which Ribonuclease P protein subunit p21 is involved: Pathways in which Ribonuclease P protein subunit p21 is involved:

NCBI GI number(s): 312283729
312283728
312283732
312283731
312283730
13376253
Species: Homo sapiens

Links to other databases:

Database ID Link
Uniprot Q9H633 Q9H633
BRENDA - -
KEGG hsa:79897 hsa:79897
PFAM: PF04032
PF04032
InterPro: IPR007175
IPR007175
CATH: - -
SCOP: - -


Protein sequence:
MAGPVKDREAFQRLNFLYQAAHCVLAQDPENQALARFYCYTERTIAKRLV
LRRDPSVKRTLCRGCSSLLVPGLTCTQRQRRCRGQRWTVQTCLTCQRSQR
FLNDPGHLLWGDRPEAQLGSQADSKPLQPLPNTAHSISDRLPEEKMQTQG
SSNQ

Ribonuclease P protein subunit p21 (Homo sapiens) is product of expression of Rpp21 gene.

Ribonuclease P protein subunit p21 (Homo sapiens) belongs to following protein families:
References:

Title Authors Journal Publication date (Issue) PubMed ID
Function and subnuclear distribution of Rpp21, a protein subunit of the human ribonucleoprotein ribonuclease P. Jarrous N, Reiner R, Wesolowski D, Mann H, Guerrier-Takada C, Altman S RNA 2001-08-01 (7) 11497433
The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, K Genome Res 2004-10-01 (14) 15489334
Complete sequencing and characterization of 21,243 full-length human cDNAs. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K Nat Genet 2004-02-01 (36) 14702039
The DNA sequence and analysis of human chromosome 6. Mungall AJ, Palmer SA, Sims SK, Edwards CA, Ashurst JL, Wilming L, Jones MC, Horton R, Hunt SE, Scott CE Nature 2003-10-23 (425) 14574404



Add your own comment!


There are no comments yet.

Last modification of this entry: 2012-04-04 10:37:26
Edited by a user: kaja
Edited content: Changed interacting_proteins.

Welcome stranger! Click here to login or here to register.