Welcome! Click here to login or here to register.
Home
Pathways
Proteins
Catalytic RNA molecules
Enzymatic complexes
Structures
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

Exosome complex exonuclease DIS3

 
Known also as: Chromosome disjunction protein 3, Ribosomal RNA-processing protein 44

Known abbreviations: DIS3, RRP44, YOL021C, O2197

FUNCTION:

  • Component of the exosome (3'->5' exoribonuclease complex) (PMID: 9390555, 10508172)
  • 3'-5' exonuclease activity mediated by the RNB domain and additional endoribonuclease activity mediated by N-terminal PIN domain (PMID:19060886, 19060898, 19125167, 17643380 ) - endonuclease activity is stimulated by a 5' monophosphate (PMID: 19060898, 19125167)
  • crucial role in the the exsosome complex activity (core exosome (CE) in yeast have no phosphorolytic active sites at all and only association Rrp44 with CE provides the sole source of exosome 3' - 5' exoribonuclease activity) (PMID: 17643380, 17942686)
  • Required for degradation of 3'-end of the 7S pre-RNA to generate mature 5.8S (S) rRNA and 5.8S(L) rRNA (cleavage at site C2 in 3'-5' direction) (PMID: 9390555, 9463390)
  • Required for degradation of 5' end of the 35S pre-rRNA in 3'-5' direction (cleavage at site A0) (PMID: 11404326, 9463390, 10465791)
  • directly role in RNA substrate recognition by exosome (PMID: 17643380)
  • Probable interactions with both 3' and 5' ends of substrate RNAs:
    • RNA might go through the center of the PH ring and then Rrp44 as 3' exoRNase can interact with 3' end of substrat,
    • RNA may gain access to Rrp44 more directly, without going through the PH ring and then Rrp44 can interact with 5' end of substrat (PMID: 19060898)
  • Associated with the Gsp1p (Gsp1p - GTP-binding protein involved in nucleocytoplasmic transport, belongs to the small GTPase superfamily and Ran family, may regulate assembly/disassembly of the exsosome) (PMID: 11404326)
  • probable participation in pre-mRNA splicing (PMID: 11404326)
  • tRNA catabolic process (recognition and participation in degradation of the hypomodified tRNAMet)(PMID: 17643380, 15145828)

COFACTOR:

Mg(2+).

CELLULAR LOCALIZATION:

  • cytoplasmic exosome (RNase complex) (PMID: 10611222)
  • nuclear exosome (RNase complex) (PMID: 17643380, 10611222)
  • mitochondrion (SGD)

SUBUNIT STRUCTURE:

Component of the exosome multienzyme ribonuclease complex composed of 10 core proteins: the ring-forming non-catalytic subunits CSL4, MTR3, RRP4, RRP40, RRP42, RRP43, RRP45, RRP46 and SKI6/RRP41, and the catalytic subunit DIS3/RRP44. In the nucleus, exosome core is associated with at least RRP6 and LRP1/RRP47. Exosome nine subunit ring structure interacts with SKI7. Interacts with GSP1.

DOMAIN ARCHITECTURE:

Protein length: 969 aa (UniProt)
PINc : 86 - 203 (InterPro)
RNB_domain: 531 - 864
S1: 904 - 1001




This protein can be a part of a given complexes: Activities in which Exosome complex exonuclease DIS3 is involved: Pathways in which Exosome complex exonuclease DIS3 is involved:

NCBI GI number(s): 2500547
Species: Saccharomyces cerevisiae

Links to other databases:

Database ID Link
Uniprot Q08162 Q08162
BRENDA - -
KEGG sce:YOL021C sce:YOL021C
PFAM: PF00773
PF00773
InterPro: IPR006596
IPR003029
IPR022967
IPR001900
IPR022966
IPR006596
IPR003029
IPR022967
IPR001900
IPR022966
CATH: - -
SCOP: - -
Solved crystal structures: 2VNU
2WP8
[PDB] [details]
[PDB] [details]


Protein sequence:
MSVPAIAPRRKRLADGLSVTQKVFVRSRNGGATKIVREHYLRSDIPCLSR
SCTKCPQIVVPDAQNELPKFILSDSPLELSAPIGKHYVVLDTNVVLQAID
LLENPNCFFDVIVPQIVLDEVRNKSYPVYTRLRTLCRDSDDHKRFIVFHN
EFSEHTFVERLPNETINDRNDRAIRKTCQWYSEHLKPYDINVVLVTNDRL
NREAATKEVESNIITKSLVQYIELLPNADDIRDSIPQMDSFDKDLERDTF
SDFTFPEYYSTARVMGGLKNGVLYQGNIQISEYNFLEGSVSLPRFSKPVL
IVGQKNLNRAFNGDQVIVELLPQSEWKAPSSIVLDSEHFDVNDNPDIEAG
DDDDNNESSSNTTVISDKQRRLLAKDAMIAQRSKKIQPTAKVVYIQRRSW
RQYVGQLAPSSVDPQSSSTQNVFVILMDKCLPKVRIRTRRAAELLDKRIV
ISIDSWPTTHKYPLGHFVRDLGTIESAQAETEALLLEHDVEYRPFSKKVL
ECLPAEGHDWKAPTKLDDPEAVSKDPLLTKRKDLRDKLICSIDPPGCVDI
DDALHAKKLPNGNWEVGVHIADVTHFVKPGTALDAEGAARGTSVYLVDKR
IDMLPMLLGTDLCSLKPYVDRFAFSVIWELDDSANIVNVNFMKSVIRSRE
AFSYEQAQLRIDDKTQNDELTMGMRALLKLSVKLKQKRLEAGALNLASPE
VKVHMDSETSDPNEVEIKKLLATNSLVEEFMLLANISVARKIYDAFPQTA
MLRRHAAPPSTNFEILNEMLNTRKNMSISLESSKALADSLDRCVDPEDPY
FNTLVRIMSTRCMMAAQYFYSGAYSYPDFRHYGLAVDIYTHFTSPIRRYC
DVVAHRQLAGAIGYEPLSLTHRDKNKMDMICRNINRKHRNAQFAGRASIE
YYVGQVMRNNESTETGYVIKVFNNGIVVLVPKFGVEGLIRLDNLTEDPNS
AAFDEVEYKLTFVPTNSDKPRDVYVFDKVEVQVRSVMDPITSKRKAELLL
K

Exosome complex exonuclease DIS3 (Saccharomyces cerevisiae) is product of expression of DIS3 gene.

Exosome complex exonuclease DIS3 (Saccharomyces cerevisiae) belongs to following protein families:
References:

Title Authors Journal Publication date (Issue) PubMed ID
Functions of the exosome in rRNA, snoRNA and snRNA synthesis. Allmang C, Kufel J, Chanfreau G, Mitchell P, Petfalski E, Tollervey D EMBO J 1999-10-01 (18) 10508172
Reconstitution, activities, and structure of the eukaryotic RNA exosome. Liu Q, Greimann JC, Lima CD Cell 2006-12-15 (127) 17174896
Global analysis of protein localization in budding yeast. Huh WK, Falvo JV, Gerke LC, Carroll AS, Howson RW, Weissman JS, O'Shea EK Nature 2003-10-16 (425) 14562095
The exosome: a conserved eukaryotic RNA processing complex containing multiple 3'-->5' exoribonucleases. Mitchell P, Petfalski E, Shevchenko A, Mann M, Tollervey D Cell 1997-11-14 (91) 9390555
Dob1p (Mtr4p) is a putative ATP-dependent RNA helicase required for the 3' end formation of 5.8S rRNA in Saccharomyces cerevisiae. de la Cruz J, Kressler D, Tollervey D, Linder P EMBO J 1998-01-16 (17) 9463390
The yeast exosome and human PM-Scl are related complexes of 3' --> 5' exonucleases. Allmang C, Petfalski E, Podtelejnikov A, Mann M, Tollervey D, Mitchell P Genes Dev 1999-08-15 (13) 10465791
Yeast exosome mutants accumulate 3'-extended polyadenylated forms of U4 small nuclear RNA and small nucleolar RNAs. van Hoof A, Lennertz P, Parker R Mol Cell Biol 2000-02-01 (20) 10611222
Exoribonuclease superfamilies: structural analysis and phylogenetic distribution. Zuo Y, Deutscher MP Nucleic Acids Res 2001-03-01 (29) 11222749
The Saccharomyces cerevisiae small GTPase, Gsp1p/Ran, is involved in 3' processing of 7S-to-5.8S rRNA and in degradation of the excised 5'-A0 fragment of 35S pre-rRNA, both of which are carried out by Suzuki N, Noguchi E, Nakashima N, Oki M, Ohba T, Tartakoff A, Ohishi M, Nishimoto T Genetics 2001-06-01 (158) 11404326
The exosome subunit Rrp44 plays a direct role in RNA substrate recognition. Schneider C, Anderson JT, Tollervey D Mol Cell 2007-07-20 (27) 17643380
Architecture of the yeast Rrp44 exosome complex suggests routes of RNA recruitment for 3' end processing. Wang HW, Wang J, Ding F, Callahan K, Bratkowski MA, Butler JS, Nogales E, Ke A Proc Natl Acad Sci U S A 2007-10-23 (104) 17942686
Endonucleolytic RNA cleavage by a eukaryotic exosome. Lebreton A, Tomecki R, Dziembowski A, Seraphin B Nature 2008-12-18 (456) 19060886
The exosome contains domains with specific endoribonuclease, exoribonuclease and cytoplasmic mRNA decay activities. Schaeffer D, Tsanova B, Barbas A, Reis FP, Dastidar EG, Sanchez-Rotunno M, Arraiano CM, van Hoof A Nat Struct Mol Biol 2009-02-01 (16) 19060898
Nuclear surveillance and degradation of hypomodified initiator tRNAMet in S. cerevisiae. Kadaba S, Krueger A, Trice T, Krecic AM, Hinnebusch AG, Anderson J Genes Dev 2004-06-01 (18) 15145828
The nucleotide sequence of Saccharomyces cerevisiae chromosome XV. Dujon B, Albermann K, Aldea M, Alexandraki D, Ansorge W, Arino J, Benes V, Bohn C, Bolotin-Fukuhara M, Bordonne R, Boyer J, Camasses A, Casamayor A, Casas C, Cheret G, Cziepluch C, Daignan-Fornier B, Dang DV, de Haan M, Delius H, Durand P, Fairhead C, Feldmann H, Gaillon L, Kleine K, et al. Nature 1997-05-01 (387) 9169874
A single subunit, Dis3, is essentially responsible for yeast exosome core activity. Dziembowski A, Lorentzen E, Conti E, Seraphin B Nat Struct Mol Biol 2007-02-01 (14) 17173052
Global analysis of protein expression in yeast. Ghaemmaghami S, Huh WK, Bower K, Howson RW, Belle A, Dephoure N, O'Shea EK, Weissman JS Nature 2003-10-16 (425) 14562106
The proteome of Saccharomyces cerevisiae mitochondria. Sickmann A, Reinders J, Wagner Y, Joppich C, Zahedi R, Meyer HE, Schonfisch B, Perschil I, Chacinska A, Guiard B, Rehling P, Pfanner N, Meisinger C Proc Natl Acad Sci U S A 2003-11-11 (100) 14576278
The yeast exosome functions as a macromolecular cage to channel RNA substrates for degradation. Bonneau F, Basquin J, Ebert J, Lorentzen E, Conti E Cell 2009-10-01 (139) 19879841
Dis3, implicated in mitotic control, binds directly to Ran and enhances the GEF activity of RCC1. Noguchi E, Hayashi N, Azuma Y, Seki T, Nakamura M, Nakashima N, Yanagida M, He X, Mueller U, Sazer S, Nishimoto T EMBO J 1996-10-15 (15) 8896453
Toward the complete yeast mitochondrial proteome: multidimensional separation techniques for mitochondrial proteomics. Reinders J, Zahedi RP, Pfanner N, Meisinger C, Sickmann A J Proteome Res 2006-07-01 (5) 16823961
Structure of the active subunit of the yeast exosome core, Rrp44: diverse modes of substrate recruitment in the RNase II nuclease family. Lorentzen E, Basquin J, Tomecki R, Dziembowski A, Conti E Mol Cell 2008-03-28 (29) 18374646



Add your own comment!


There are no comments yet.

Last modification of this entry: 2010-04-12 22:27:34
Edited by a user: kaja
Edited content: Changed name, ncbi_gi_numbers, uniprot, alternative_names, abbreviations, species, protein_sequence and description.

Welcome stranger! Click here to login or here to register.