Welcome! Click here to login or here to register.
Home
Pathways
Proteins
Catalytic RNA molecules
Enzymatic complexes
Structures
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

Ribonuclease P protein subunit p40

 
Known also as: RNase P subunit 1

Known abbreviations: RPP40, RNASEP1

FUNCTION:

Component of ribonuclease P, a protein complex that generates mature tRNA molecules by cleaving their 5'-ends.

CATALYTIC ACTIVITY:

Endonucleolytic cleavage of RNA, removing 5'-extranucleotides from tRNA precursor.

CELLULAR LOCALIZATION:

RNase P consists of a RNA moiety and at least 8 protein subunits; POP1, RPP14, RPP20/POP7, RPP25, RPP29/POP4, RPP30, RPP38 and RPP40.

CELLULAR LOCALIZATION:

Nucleus › nucleolus (Potential).



This protein can be a part of a given complexes: Activities in which Ribonuclease P protein subunit p40 is involved: Pathways in which Ribonuclease P protein subunit p40 is involved:

NCBI GI number(s): 55743132
55743131
Species: Homo sapiens

Links to other databases:

Database ID Link
Uniprot O75818 O75818
BRENDA - -
KEGG hsa:10799 hsa:10799
PFAM: PF08584
PF08584
InterPro: IPR013893
IPR013893
CATH: - -
SCOP: - -


Protein sequence:
MATLRRLREAPRHLLVCEKSNFGNHKSRHRHLVQTHYYNYRVSFLIPECG
ILSEELKNLVMNTGPYYFVKNLPLHELITPEFISTFIKKGSCYALTYNTH
IDEDNTVALLPNGKLILSLDKDTYEETGLQGHPSQFSGRKIMKFIVSIDL
MELSLNLDSKKYERISWSFKEKKPLKFDFLLAWHKTGSEESTMMSYFSKY
QIQEHQPKVALSTLRDLQCPVLQSSELEGTPEVSCRALELFDWLGAVFSN
VDLNNEPNNFISTYCCPEPSTVVAKAYLCTITGFILPEKICLLLEHLCHY
FDEPKLAPWVTLSVQGFADSPVSWEKNEHGFRKGGEHLYNFVIFNNQDYW
LQMAVGANDHCPP

Ribonuclease P protein subunit p40 (Homo sapiens) is product of expression of Rpp40 gene.

Ribonuclease P protein subunit p40 (Homo sapiens) belongs to following protein families:
References:

Title Authors Journal Publication date (Issue) PubMed ID
The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, K Genome Res 2004-10-01 (14) 15489334
Autoantigenic properties of some protein subunits of catalytically active complexes of human ribonuclease P. Jarrous N, Eder PS, Guerrier-Takada C, Hoog C, Altman S RNA 1998-04-01 (4) 9630247
The DNA sequence and analysis of human chromosome 6. Mungall AJ, Palmer SA, Sims SK, Edwards CA, Ashurst JL, Wilming L, Jones MC, Horton R, Hunt SE, Scott CE Nature 2003-10-23 (425) 14574404



Add your own comment!


There are no comments yet.

Last modification of this entry: 2013-02-01 13:55:55
Edited by a user: kaja
Edited content: Changed protein_family.

Welcome stranger! Click here to login or here to register.