|
Known also as: Ribosomal RNA-processing protein 43
Known abbreviations: RRP43, YCR035C, YCR35C, YCR522
FUNCTION:
- exosome component without exonuclease activity (PMID: 17942686)
- Required for degradation of 3'-end of the 7S pre-RNA to generate mature 5.8S (S) rRNA and 5.8S(L) rRNA (cleavage at site C2 in 3'-5' direction) (PMID: 9390555, 9463390, 12364597), interaction with Nip7p for removal of ITS2 (PMID: 9891085)
- Required for degradation of 5' end of the 35S pre-rRNA in 3'-5' direction (cleavage at site A0) (PMID: 9463390, 10465791, 12364597)
- Required for mRNA degradation (PMID: 12364597)
CELLULAR LOCALIZATION:
- cytoplasmic exosome (RNase complex) (PMID: 10465791, 12364597, 9891085)
- nuclear exosome (RNase complex) (PMID: 10465791, 9891085)
- nucleolus (PMID: 9891085)
- nucleoplasm (PMID: 9891085)
DOMAIN ARCHITECTURE:
protein lenght: 394 aa (UniProt)
PH_domain1: 30 - 155(InterPro)
PH_domain2: 183 - 254
SUBUNIT STRUCTURE:
Component of the RNA exosome complex. Specifically part of the catalytically inactive RNA exosome core (Exo-9) complex which associates with catalytic subunits DIS3 and RRP6 in cytoplasmic- and nuclear-specific RNA exosome complex forms. Exo-9 is formed by a hexameric ring of RNase PH domain-containing subunits and peripheral S1 domain-containing components CSL4, RRP4 and RRP40 located on the top of the ring structure. Interacts with NIP7 and NOP8. Interacts strongly with RRP46.
|
This protein can be a part of a given complexes:
Links to other databases:
Protein sequence:
MAESTTLETIEIHPITFPPEVLARISPELSLQRHLSLGIRPCLRKYEEFR
DVAIENNTLSRYADAGNIDTKNNILGSNVLKSGKTIVITSITGGIIEETS
AAIKDLDDFGEEELFEVTKEEDIIANYASVYPVVEVERGRVGACTDEEMT
ISQKLHDSILHSRILPKKALKVKAGVRSANEDGTFSVLYPDELEDDTLNE
TNLKMKRKWSYVLYAKIVVLSRTGPVFDLCWNSLMYALQSVKLPRAFIDE
RASDLRMTIRTRGRSATIRETYEIICDQTKSVPLMINAKNIAFASNYGIV
ELDPECQLQNSDNSEEEEVDIDMDKLNTVLIADLDTEAEETSIHSTISIL
AAPSGNYKQLTLVGGGAKITPEMIKRSLLLSRVRADDLSTRFNI
|
Exosome complex component RRP43 (Saccharomyces cerevisiae) is product of expression of
RRP43
gene.
Exosome complex component RRP43 (Saccharomyces cerevisiae) belongs to following protein families:
References:
Title |
Authors |
Journal
| Publication date (Issue)
| PubMed ID
|
Reconstitution, activities, and structure of the eukaryotic RNA exosome. |
Liu Q, Greimann JC, Lima CD |
Cell
|
2006-12-15 (127) |
17174896 |
Global analysis of protein localization in budding yeast. |
Huh WK, Falvo JV, Gerke LC, Carroll AS, Howson RW, Weissman JS, O'Shea EK |
Nature
|
2003-10-16 (425) |
14562095 |
The exosome: a conserved eukaryotic RNA processing complex containing multiple 3'-->5' exoribonucleases. |
Mitchell P, Petfalski E, Shevchenko A, Mann M, Tollervey D |
Cell
|
1997-11-14 (91) |
9390555 |
The yeast exosome and human PM-Scl are related complexes of 3' --> 5' exonucleases. |
Allmang C, Petfalski E, Podtelejnikov A, Mann M, Tollervey D, Mitchell P |
Genes Dev
|
1999-08-15 (13) |
10465791 |
Yeast exosome mutants accumulate 3'-extended polyadenylated forms of U4 small nuclear RNA and small nucleolar RNAs. |
van Hoof A, Lennertz P, Parker R |
Mol Cell Biol
|
2000-02-01 (20) |
10611222 |
Temperature-sensitive mutants of the exosome subunit Rrp43p show a deficiency in mRNA degradation and no longer interact with the exosome. |
Oliveira CC, Gonzales FA, Zanchin NI |
Nucleic Acids Res
|
2002-10-01 (30) |
12364597 |
Nip7p interacts with Nop8p, an essential nucleolar protein required for 60S ribosome biogenesis, and the exosome subunit Rrp43p. |
Zanchin NI, Goldfarb DS |
Mol Cell Biol
|
1999-01-01 (19) |
9891085 |
The complete DNA sequence of yeast chromosome III. |
Oliver SG, van der Aart QJ, Agostoni-Carbone ML, Aigle M, Alberghina L, Alexandraki D, Antoine G, Anwar R, Ballesta JP, Benit P, et al. |
Nature
|
1992-05-07 (357) |
1574125 |
A single subunit, Dis3, is essentially responsible for yeast exosome core activity. |
Dziembowski A, Lorentzen E, Conti E, Seraphin B |
Nat Struct Mol Biol
|
2007-02-01 (14) |
17173052 |
Global analysis of protein expression in yeast. |
Ghaemmaghami S, Huh WK, Bower K, Howson RW, Belle A, Dephoure N, O'Shea EK, Weissman JS |
Nature
|
2003-10-16 (425) |
14562106 |
A multidimensional chromatography technology for in-depth phosphoproteome analysis. |
Albuquerque CP, Smolka MB, Payne SH, Bafna V, Eng J, Zhou H |
Mol Cell Proteomics
|
2008-07-01 (7) |
18407956 |
The complete sequence of the 8.2 kb segment left of MAT on chromosome III reveals five ORFs, including a gene for a yeast ribokinase. |
Thierry A, Fairhead C, Dujon B |
Yeast
|
1990-01-01 (6) |
1964349 |
The complete sequence of a 7.5 kb region of chromosome III from Saccharomyces cerevisiae that lies between CRY1 and MAT. |
Wicksteed BL, Roberts AB, Sagliocco FA, Brown AJ |
Yeast
|
1991-10-01 (7) |
1776366 |
The exosome subunit Rrp43p is required for the efficient maturation of 5.8S, 18S and 25S rRNA. |
Zanchin NI, Goldfarb DS |
Nucleic Acids Res
|
1999-03-01 (27) |
9973615 |
Add your own comment!
There are no comments yet.
Last modification of this entry: 2012-07-05 14:29:07
Edited by a user: kaja
Edited content: Changed publications.
|