Welcome! Click here to login or here to register.
Home
Pathways
Proteins
Catalytic RNA molecules
Enzymatic complexes
Structures
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

Exosome complex component RRP43
 
Known also as: Ribosomal RNA-processing protein 43

Known abbreviations: RRP43, YCR035C, YCR35C, YCR522

FUNCTION:

  • exosome component without exonuclease activity (PMID: 17942686)
  • Required for degradation of 3'-end of the 7S pre-RNA to generate mature 5.8S (S) rRNA and 5.8S(L) rRNA (cleavage at site C2 in 3'-5' direction) (PMID: 9390555, 9463390, 12364597), interaction with Nip7p for removal of ITS2 (PMID: 9891085)
  • Required for degradation of 5' end of the 35S pre-rRNA in 3'-5' direction (cleavage at site A0) (PMID: 9463390, 10465791, 12364597)
  • Required for mRNA degradation (PMID: 12364597)

CELLULAR LOCALIZATION:

  • cytoplasmic exosome (RNase complex) (PMID: 10465791, 12364597, 9891085)
  • nuclear exosome (RNase complex) (PMID: 10465791, 9891085)
  • nucleolus (PMID: 9891085)
  • nucleoplasm (PMID: 9891085)

DOMAIN ARCHITECTURE:

protein lenght: 394 aa (UniProt)
PH_domain1: 30 - 155(InterPro)
PH_domain2: 183 - 254

SUBUNIT STRUCTURE:

Component of the RNA exosome complex. Specifically part of the catalytically inactive RNA exosome core (Exo-9) complex which associates with catalytic subunits DIS3 and RRP6 in cytoplasmic- and nuclear-specific RNA exosome complex forms. Exo-9 is formed by a hexameric ring of RNase PH domain-containing subunits and peripheral S1 domain-containing components CSL4, RRP4 and RRP40 located on the top of the ring structure. Interacts with NIP7 and NOP8. Interacts strongly with RRP46.


This protein can be a part of a given complexes:
NCBI GI number(s): 10383796
296143063
Species: Saccharomyces cerevisiae

Links to other databases:

Database ID Link
Uniprot P25359 P25359
BRENDA - -
KEGG sce:YCR035C sce:YCR035C
PFAM: PF01138
PF01138
InterPro: IPR001247
IPR020568
 IPR001247
IPR020568
CATH: - -
SCOP: - -


Protein sequence:
MAESTTLETIEIHPITFPPEVLARISPELSLQRHLSLGIRPCLRKYEEFR
DVAIENNTLSRYADAGNIDTKNNILGSNVLKSGKTIVITSITGGIIEETS
AAIKDLDDFGEEELFEVTKEEDIIANYASVYPVVEVERGRVGACTDEEMT
ISQKLHDSILHSRILPKKALKVKAGVRSANEDGTFSVLYPDELEDDTLNE
TNLKMKRKWSYVLYAKIVVLSRTGPVFDLCWNSLMYALQSVKLPRAFIDE
RASDLRMTIRTRGRSATIRETYEIICDQTKSVPLMINAKNIAFASNYGIV
ELDPECQLQNSDNSEEEEVDIDMDKLNTVLIADLDTEAEETSIHSTISIL
AAPSGNYKQLTLVGGGAKITPEMIKRSLLLSRVRADDLSTRFNI

Exosome complex component RRP43 (Saccharomyces cerevisiae) is product of expression of RRP43 gene.

Exosome complex component RRP43 (Saccharomyces cerevisiae) belongs to following protein families:
References:

Title Authors Journal Publication date (Issue) PubMed ID
Reconstitution, activities, and structure of the eukaryotic RNA exosome. Liu Q, Greimann JC, Lima CD Cell 2006-12-15 (127) 17174896
Global analysis of protein localization in budding yeast. Huh WK, Falvo JV, Gerke LC, Carroll AS, Howson RW, Weissman JS, O'Shea EK Nature 2003-10-16 (425) 14562095
The exosome: a conserved eukaryotic RNA processing complex containing multiple 3'-->5' exoribonucleases. Mitchell P, Petfalski E, Shevchenko A, Mann M, Tollervey D Cell 1997-11-14 (91) 9390555
The yeast exosome and human PM-Scl are related complexes of 3' --> 5' exonucleases. Allmang C, Petfalski E, Podtelejnikov A, Mann M, Tollervey D, Mitchell P Genes Dev 1999-08-15 (13) 10465791
Yeast exosome mutants accumulate 3'-extended polyadenylated forms of U4 small nuclear RNA and small nucleolar RNAs. van Hoof A, Lennertz P, Parker R Mol Cell Biol 2000-02-01 (20) 10611222
Temperature-sensitive mutants of the exosome subunit Rrp43p show a deficiency in mRNA degradation and no longer interact with the exosome. Oliveira CC, Gonzales FA, Zanchin NI Nucleic Acids Res 2002-10-01 (30) 12364597
Nip7p interacts with Nop8p, an essential nucleolar protein required for 60S ribosome biogenesis, and the exosome subunit Rrp43p. Zanchin NI, Goldfarb DS Mol Cell Biol 1999-01-01 (19) 9891085
The complete DNA sequence of yeast chromosome III. Oliver SG, van der Aart QJ, Agostoni-Carbone ML, Aigle M, Alberghina L, Alexandraki D, Antoine G, Anwar R, Ballesta JP, Benit P, et al. Nature 1992-05-07 (357) 1574125
A single subunit, Dis3, is essentially responsible for yeast exosome core activity. Dziembowski A, Lorentzen E, Conti E, Seraphin B Nat Struct Mol Biol 2007-02-01 (14) 17173052
Global analysis of protein expression in yeast. Ghaemmaghami S, Huh WK, Bower K, Howson RW, Belle A, Dephoure N, O'Shea EK, Weissman JS Nature 2003-10-16 (425) 14562106
A multidimensional chromatography technology for in-depth phosphoproteome analysis. Albuquerque CP, Smolka MB, Payne SH, Bafna V, Eng J, Zhou H Mol Cell Proteomics 2008-07-01 (7) 18407956
The complete sequence of the 8.2 kb segment left of MAT on chromosome III reveals five ORFs, including a gene for a yeast ribokinase. Thierry A, Fairhead C, Dujon B Yeast 1990-01-01 (6) 1964349
The complete sequence of a 7.5 kb region of chromosome III from Saccharomyces cerevisiae that lies between CRY1 and MAT. Wicksteed BL, Roberts AB, Sagliocco FA, Brown AJ Yeast 1991-10-01 (7) 1776366
The exosome subunit Rrp43p is required for the efficient maturation of 5.8S, 18S and 25S rRNA. Zanchin NI, Goldfarb DS Nucleic Acids Res 1999-03-01 (27) 9973615


Add your own comment!


There are no comments yet.

Last modification of this entry: 2012-07-05 14:29:07
Edited by a user: kaja
Edited content: Changed publications.

Welcome stranger! Click here to login or here to register.