Welcome! Click here to login or here to register.
Home
Pathways
Proteins
Catalytic RNA molecules
Enzymatic complexes
Structures
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

Exosome complex component RRP46

 
Known also as: Ribosomal RNA-processing protein 46

Known abbreviations: RRP46, YGR095C

FUNCTION:

  • exosome component without exonuclease activity (PMID: 17942686)
  • Required for degradation of 3'-end of the 7S pre-RNA to generate mature 5.8S (S) rRNA and 5.8S(L) rRNA (cleavage at site C2 in 3'-5' direction) (PMID: 10465791)

CELLULAR LOCALIZATION:

  • cytoplasmic exosome (RNase complex) (PMID: 10465791)
  • nuclear exosome (RNase complex) (PMID: 10465791)
  • nucleolus (UniProt)

SUBUNIT STRUCTURE:

Component of the RNA exosome complex. Specifically part of the catalytically inactive RNA exosome core (Exo-9) complex which associates with catalytic subunits DIS3 and RRP6 in cytoplasmic- and nuclear-specific RNA exosome complex forms. Exo-9 is formed by a hexameric ring of RNase PH domain-containing subunits and peripheral S1 domain-containing components CSL4, RRP4 and RRP40 located on the top of the ring structure. Interacts with LRP1.

INTERACTION:

RRP46 interacts with Rrp43 (PMID: 17174896), poly(A) polymerase and with Npl3p (a poly(A) + mRNA binding protein implicated in pre-mRNA processing and mRNA nuclear export) (PMID: 10611239 )



This protein can be a part of a given complexes:
NCBI GI number(s): 37362654
296145127
Species: Saccharomyces cerevisiae

Links to other databases:

Database ID Link
Uniprot P53256 P53256
BRENDA - -
KEGG sce:YGR095C sce:YGR095C
PFAM: PF01138
PF03725
PF01138
PF03725
InterPro: IPR001247
IPR015847
IPR020568
IPR001247
IPR015847
IPR020568
CATH: - -
SCOP: - -


Protein sequence:
MSVQAEIGILDHVDGSSEFVSQDTKVICSVTGPIEPKARQELPTQLALEI
IVRPAKGVATTREKVLEDKLRAVLTPLITRHCYPRQLCQITCQILESGED
EAEFSLRELSCCINAAFLALVDAGIALNSMCASIPIAIIKDTSDIIVDPT
AEQLKISLSVHTLALEFVNGGKVVKNVLLLDSNGDFNEDQLFSLLELGEQ
KCQELVTNIRRIIQDNISPRLVV

Exosome complex component RRP46 (Saccharomyces cerevisiae) is product of expression of RRP46 gene.

Exosome complex component RRP46 (Saccharomyces cerevisiae) belongs to following protein families:
References:

Title Authors Journal Publication date (Issue) PubMed ID
Reconstitution, activities, and structure of the eukaryotic RNA exosome. Liu Q, Greimann JC, Lima CD Cell 2006-12-15 (127) 17174896
Global analysis of protein localization in budding yeast. Huh WK, Falvo JV, Gerke LC, Carroll AS, Howson RW, Weissman JS, O'Shea EK Nature 2003-10-16 (425) 14562095
The yeast exosome and human PM-Scl are related complexes of 3' --> 5' exonucleases. Allmang C, Petfalski E, Podtelejnikov A, Mann M, Tollervey D, Mitchell P Genes Dev 1999-08-15 (13) 10465791
A nuclear 3'-5' exonuclease involved in mRNA degradation interacts with Poly(A) polymerase and the hnRNA protein Npl3p. Burkard KT, Butler JS Mol Cell Biol 2000-02-01 (20) 10611239
The nucleotide sequence of Saccharomyces cerevisiae chromosome VII. Tettelin H, Agostoni Carbone ML, Albermann K, Albers M, Arroyo J, Backes U, Barreiros T, Bertani I, Bjourson AJ, Bruckner M, Bruschi CV, Carignani G, Castagnoli L, Cerdan E, Clemente ML, Coblenz A, Coglievina M, Coissac E, Defoor E, Del Bino S, Delius H, Delneri D, de Wergifosse P, Dujon B, Kleine K Nature 1997-05-01 (387) 9169869
A single subunit, Dis3, is essentially responsible for yeast exosome core activity. Dziembowski A, Lorentzen E, Conti E, Seraphin B Nat Struct Mol Biol 2007-02-01 (14) 17173052
Global analysis of protein expression in yeast. Ghaemmaghami S, Huh WK, Bower K, Howson RW, Belle A, Dephoure N, O'Shea EK, Weissman JS Nature 2003-10-16 (425) 14562106
A panoramic view of yeast noncoding RNA processing. Peng WT, Robinson MD, Mnaimneh S, Krogan NJ, Cagney G, Morris Q, Davierwala AP, Grigull J, Yang X, Zhang W, Mitsakakis N, Ryan OW, Datta N, Jojic V, Pal C, Canadien V, Richards D, Beattie B, Wu LF, Altschuler SJ, Roweis S, Frey BJ, Emili A, Greenblatt JF, Hughes TR Cell 2003-06-27 (113) 12837249
Sequencing and comparison of yeast species to identify genes and regulatory elements. Kellis M, Patterson N, Endrizzi M, Birren B, Lander ES Nature 2003-05-15 (423) 12748633



Add your own comment!


There are no comments yet.

Last modification of this entry: Sept. 25, 2012.

Welcome stranger! Click here to login or here to register.