|
Known also as: mRNA transport regulator 3
Known abbreviations: MTR3, YGR158C, G6676
FUNCTION:
- exosome component without exonuclease activity (PMID: 17942686)
- Required for degradation of 3'-end of the 7S pre-RNA to generate mature 5.8S (S) rRNA and 5.8S(L) rRNA (cleavage at site C2 in 3'-5' direction) (PMID: 10465791)
- Required for the 3'-processing of U4 snRNA (PMID: 10611222)
- Required for the 3'-processing of snoRNA (PMID: 10611222)
CELLULAR LOCALIZATION:
- cytoplasmic exosome (RNase complex) (PMID: 10465791)
- nuclear exosome (RNase complex) (PMID: 10465791)
DOMAIN ARCHITECTURE:
protein lenght: 250 aa (UniProt)
PH_domain1: 42 - 186 (InterPro)
SUBUNIT STRUCTURE:
Component of the RNA exosome complex. Specifically part of the catalytically inactive RNA exosome core (Exo-9) complex which associates with catalytic subunits DIS3 and RRP6 in cytoplasmic- and nuclear-specific RNA exosome complex forms. Exo-9 is formed by a hexameric ring of RNase PH domain-containing subunits and peripheral S1 domain-containing components CSL4, RRP4 and RRP40 located on the top of the ring structure.
|
This protein can be a part of a given complexes:
Links to other databases:
Protein sequence:
MNVQDRRRLLGPAAAKPMAFSNTTTHVPEKKSTDLTPKGNESEQELSLHT
GFIENCNGSALVEARSLGHQTSLITAVYGPRSIRGSFTSQGTISIQLKNG
LLEKYNTNELKEVSSFLMGIFNSVVNLSRYPKSGIDIFVYLTYDKDLTNN
PQDDDSQSKMMSSQISSLIPHCITSITLALADAGIELVDMAGAGEANGTV
VSFIKNGEEIVGFWKDDGDDEDLLECLDRCKEQYNRYRDLMISCLMNQET
|
Exosome complex component MTR3 (Saccharomyces cerevisiae) is product of expression of
MTR3
gene.
References:
Title |
Authors |
Journal
| Publication date (Issue)
| PubMed ID
|
Reconstitution, activities, and structure of the eukaryotic RNA exosome. |
Liu Q, Greimann JC, Lima CD |
Cell
|
2006-12-15 (127) |
17174896 |
Global analysis of protein localization in budding yeast. |
Huh WK, Falvo JV, Gerke LC, Carroll AS, Howson RW, Weissman JS, O'Shea EK |
Nature
|
2003-10-16 (425) |
14562095 |
The yeast exosome and human PM-Scl are related complexes of 3' --> 5' exonucleases. |
Allmang C, Petfalski E, Podtelejnikov A, Mann M, Tollervey D, Mitchell P |
Genes Dev
|
1999-08-15 (13) |
10465791 |
The nucleotide sequence of Saccharomyces cerevisiae chromosome VII. |
Tettelin H, Agostoni Carbone ML, Albermann K, Albers M, Arroyo J, Backes U, Barreiros T, Bertani I, Bjourson AJ, Bruckner M, Bruschi CV, Carignani G, Castagnoli L, Cerdan E, Clemente ML, Coblenz A, Coglievina M, Coissac E, Defoor E, Del Bino S, Delius H, Delneri D, de Wergifosse P, Dujon B, Kleine K |
Nature
|
1997-05-01 (387) |
9169869 |
A single subunit, Dis3, is essentially responsible for yeast exosome core activity. |
Dziembowski A, Lorentzen E, Conti E, Seraphin B |
Nat Struct Mol Biol
|
2007-02-01 (14) |
17173052 |
Global analysis of protein expression in yeast. |
Ghaemmaghami S, Huh WK, Bower K, Howson RW, Belle A, Dephoure N, O'Shea EK, Weissman JS |
Nature
|
2003-10-16 (425) |
14562106 |
The sequence of a 27 kb segment on the right arm of chromosome VII from Saccharomyces cerevisiae reveals MOL1, NAT2, RPL30B, RSR1, CYS4, PEM1/CHO2, NSR1 genes and ten new open reading frames. |
Skala J, Nawrocki A, Goffeau A |
Yeast
|
1995-11-01 (11) |
8585325 |
Mutations in nucleolar proteins lead to nucleolar accumulation of polyA+ RNA in Saccharomyces cerevisiae. |
Kadowaki T, Schneiter R, Hitomi M, Tartakoff AM |
Mol Biol Cell
|
1995-09-01 (6) |
8534909 |
Add your own comment!
There are no comments yet.
Last modification of this entry: Sept. 25, 2012.
|