Welcome! Click here to login or here to register.
Home
Pathways
Proteins
Catalytic RNA molecules
Enzymatic complexes
Structures
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

Exosome complex component MTR3
 
Known also as: mRNA transport regulator 3

Known abbreviations: MTR3, YGR158C, G6676

FUNCTION:

  • exosome component without exonuclease activity (PMID: 17942686)
  • Required for degradation of 3'-end of the 7S pre-RNA to generate mature 5.8S (S) rRNA and 5.8S(L) rRNA (cleavage at site C2 in 3'-5' direction) (PMID: 10465791)
  • Required for the 3'-processing of U4 snRNA (PMID: 10611222)
  • Required for the 3'-processing of snoRNA (PMID: 10611222)

CELLULAR LOCALIZATION:

  • cytoplasmic exosome (RNase complex) (PMID: 10465791)
  • nuclear exosome (RNase complex) (PMID: 10465791)

DOMAIN ARCHITECTURE:

protein lenght: 250 aa (UniProt)
PH_domain1: 42 - 186 (InterPro)

SUBUNIT STRUCTURE:

Component of the RNA exosome complex. Specifically part of the catalytically inactive RNA exosome core (Exo-9) complex which associates with catalytic subunits DIS3 and RRP6 in cytoplasmic- and nuclear-specific RNA exosome complex forms. Exo-9 is formed by a hexameric ring of RNase PH domain-containing subunits and peripheral S1 domain-containing components CSL4, RRP4 and RRP40 located on the top of the ring structure.


This protein can be a part of a given complexes:
NCBI GI number(s): 6321597
296145188
Species: Saccharomyces cerevisiae

Links to other databases:

Database ID Link
Uniprot P48240 P48240
BRENDA - -
KEGG sce:YGR158C sce:YGR158C
PFAM: PF01138
PF01138
InterPro: IPR001247
 IPR001247
CATH: - -
SCOP: - -


Protein sequence:
MNVQDRRRLLGPAAAKPMAFSNTTTHVPEKKSTDLTPKGNESEQELSLHT
GFIENCNGSALVEARSLGHQTSLITAVYGPRSIRGSFTSQGTISIQLKNG
LLEKYNTNELKEVSSFLMGIFNSVVNLSRYPKSGIDIFVYLTYDKDLTNN
PQDDDSQSKMMSSQISSLIPHCITSITLALADAGIELVDMAGAGEANGTV
VSFIKNGEEIVGFWKDDGDDEDLLECLDRCKEQYNRYRDLMISCLMNQET

Exosome complex component MTR3 (Saccharomyces cerevisiae) is product of expression of MTR3 gene.

References:

Title Authors Journal Publication date (Issue) PubMed ID
Reconstitution, activities, and structure of the eukaryotic RNA exosome. Liu Q, Greimann JC, Lima CD Cell 2006-12-15 (127) 17174896
Global analysis of protein localization in budding yeast. Huh WK, Falvo JV, Gerke LC, Carroll AS, Howson RW, Weissman JS, O'Shea EK Nature 2003-10-16 (425) 14562095
The yeast exosome and human PM-Scl are related complexes of 3' --> 5' exonucleases. Allmang C, Petfalski E, Podtelejnikov A, Mann M, Tollervey D, Mitchell P Genes Dev 1999-08-15 (13) 10465791
The nucleotide sequence of Saccharomyces cerevisiae chromosome VII. Tettelin H, Agostoni Carbone ML, Albermann K, Albers M, Arroyo J, Backes U, Barreiros T, Bertani I, Bjourson AJ, Bruckner M, Bruschi CV, Carignani G, Castagnoli L, Cerdan E, Clemente ML, Coblenz A, Coglievina M, Coissac E, Defoor E, Del Bino S, Delius H, Delneri D, de Wergifosse P, Dujon B, Kleine K Nature 1997-05-01 (387) 9169869
A single subunit, Dis3, is essentially responsible for yeast exosome core activity. Dziembowski A, Lorentzen E, Conti E, Seraphin B Nat Struct Mol Biol 2007-02-01 (14) 17173052
Global analysis of protein expression in yeast. Ghaemmaghami S, Huh WK, Bower K, Howson RW, Belle A, Dephoure N, O'Shea EK, Weissman JS Nature 2003-10-16 (425) 14562106
The sequence of a 27 kb segment on the right arm of chromosome VII from Saccharomyces cerevisiae reveals MOL1, NAT2, RPL30B, RSR1, CYS4, PEM1/CHO2, NSR1 genes and ten new open reading frames. Skala J, Nawrocki A, Goffeau A Yeast 1995-11-01 (11) 8585325
Mutations in nucleolar proteins lead to nucleolar accumulation of polyA+ RNA in Saccharomyces cerevisiae. Kadowaki T, Schneiter R, Hitomi M, Tartakoff AM Mol Biol Cell 1995-09-01 (6) 8534909


Add your own comment!


There are no comments yet.

Last modification of this entry: Sept. 25, 2012.
Welcome stranger! Click here to login or here to register.