Welcome! Click here to login or here to register.
Home
Pathways
Proteins
Catalytic RNA molecules
Enzymatic complexes
Structures
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

General negative regulator of transcription subunit 1

 
Known also as: Cell division cycle protein 39

Known abbreviations: NOT1, ROS1, CDC39, YCR093W, YCR1151, YCR93W

FUNCTION:

Acts as component of the CCR4-NOT core complex, which in the nucleus seems to be a general transcription factor, and in the cytoplasm the major mRNA deadenylase involved in mRNA turnover. The NOT protein subcomplex negatively regulates the basal and activated transcription of many genes. Preferentially affects TC-type TATA element-dependent transcription. Could directly or indirectly inhibit component(s) of the general transcription machinery.

SUBUNIT:

Forms a NOT protein complex that comprises NOT1, NOT2, NOT3, NOT4 and NOT5. Subunit of the 1.0 MDa CCR4-NOT core complex that contains CCR4, CAF1, NOT1, NOT2, NOT3, NOT4, NOT5, CAF40 and CAF130. In the complex interacts with CCR4, POP2, NOT2, NOT4 and NOT5. The core complex probably is part of a less characterized 1.9 MDa CCR4-NOT complex.

CELLULAR LOCALIZATION:

Cytoplasm. Nucleus.
 




This protein can be a part of a given complexes: Activities in which General negative regulator of transcription subunit 1 is involved: Pathways in which General negative regulator of transcription subunit 1 is involved:

NCBI GI number(s): 416765
308153578
Species: Saccharomyces cerevisiae

Links to other databases:

Database ID Link
Uniprot P25655 P25655
BRENDA - -
KEGG sce:YCR093W sce:YCR093W
PFAM: PF12842
PF04054
PF12842
PF04054
InterPro: IPR007196
IPR024557
IPR007196
IPR024557
CATH: - -
SCOP: - -


Protein sequence:
MLSATYRDLNTASNLETSKEKQAAQIVIAQISLLFTTLNNDNFESVEREI
RHILDRSSVDIYIKVWERLLTLSSRDILQAGKFLLQENLLHRLLLEFAKD
LPKKSTDLIELLKERTFNNQEFQKQTGITLSLFIDLFDKSANKDIIESLD
RSSQINDFKTIKMNHTNYLRNFFLQTTPETLESNLRDLLHSLEGESLNDL
LALLLSEILSPGSQNLQNDPTRSWLTPPMVLDATNRGNVIARSISSLQAN
QINWNRVFNLMSTKYFLSAPLMPTTASLSCLFAALHDGPVIDEFFSCDWK
VIFKLDLAIQLHKWSVQNGCFDLLNAEGTRKVSETIPNTKQSLLYLLSIA
SLNLELFLQREELSDGPMLAYFQECFFEDFNYAPEYLILALVKEMKRFVL
LIENRTVIDEILITLLIQVHNKSPSSFKDVISTITDDSKIVDAAKIIINS
DDAPIANFLKSLLDTGRLDTVINKLPFNEAFKILPCARQIGWEGFDTFLK
TKVSPSNVDVVLESLEVQTKMTDTNAPFRSLKTFDLFAFHSLIEVLNKCP
LDVLQLQRFESLEFSLLIRFPRLINFGFGHDEAILANGDIAGINNDIEKE
MQNYLQKMYSGELAIKDVIELLRRLRDSDLPRDQEVFTCITHAVIAESTF
FQDYPLDALATTSVLFGSMILFQLLRGFVLDVAFRIIMRFAKEPPESKMF
KFAVQAIYAFRIRLAEYPQYCKDLLRDVPALKSQAQVYQSIVEAATLANA
PKERSRPVQEMIPLKFFAVDEVSCQINQEGAPKDVVEKVLFVLNNVTLAN
LNNKVDELKKSLTPNYFSWFSTYLVTQRAKTEPNYHDLYSKVIVAMGSGL
LHQFMVNVTLRQLFVLLSTKDEQAIDKKHLKNLASWLGCITLALNKPIKH
KNIAFREMLIEAYKENRLEIVVPFVTKILQRASESKIFKPPNPWTVGILK
LLIELNEKANWKLSLTFEVEVLLKSFNLTTKSLKPSNFINTPEVIETLSG
ALGSITLEQQQTEQQRQIILMQQHQQQMLIYQQRQQQQQQRQQQQQHHIS
ANTIADQQAAFGGEGSISHDNPFNNLLGSTIFVTHPDLKRVFQMALAKSV
REILLEVVEKSSGIAVVTTTKIILKDFATEVDESKLKTAAIIMVRHLAQS
LARATSIEPLKEGIRSTMQSLAPNLMSLSSSPAEELDTAINENIGIALVL
IEKASMDKSTQDLADQLMQAIAIRRYHKERRADQPFITQNTNPYSLSLPE
PLGLKNTGVTPQQFRVYEEFGKNIPNLDVIPFAGLPAHAPPMTQNVGLTQ
PQQQQAQMPTQILTSEQIRAQQQQQQLQKSRLNQPSQSAQPPGVNVPNPQ
GGIAAVQSDLEQNQRVLVHLMDILVSQIKENATKNNLAELGDQNQIKTII
FQILTFIAKSAQKDQLALKVSQAVVNSLFATSESPLCREVLSLLLEKLCS
LSLVARKDVVWWLVYALDSRKFNVPVIRSLLEVNLIDATELDNVLVTAMK
NKMENSTEFAMKLIQNTVLSDDPILMRMDFIKTLEHLASSEDENVKKFIK
EFEDTKIMPVRKGTKTTRTEKLYLVFTEWVKLLQRVENNDVITTVFIKQL
VEKGVISDTDNLLTFVKSSLELSVSSFKESDPTDEVFIAIDALGSLIIKL
LILQGFKDDTRRDYINAIFSVIVLVFAKDHSQEGTTFNERPYFRLFSNIL
YEWATIRTHNFVRISDSSTRQELIEFDSVFYNTFSGYLHALQPFAFPGFS
FAWVTLLSHRMLLPIMLRLPNKIGWEKLMLLIIDLFKFLDQYTSKHAVSD
AVSVVYKGTLRVILGISNDMPSFLIENHYELMNNLPPTYFQLKNVILSAI
PKNMTVPNPYDVDLNMEDIPACKELPEVFFDPVIDLHSLKKPVDNYLRIP
SNSLLRTILSAIYKDTYDIKKGVGYDFLSVDSKLIRAIVLHVGIEAGIEY
KRTSSNAVFNTKSSYYTLLFNLIQNGSIEMKYQIILSIVEQLRYPNIHTY
WFSFVLMNMFKSDEWNDQKLEVQEIILRNFLKRIIVNKPHTWGVSVFFTQ
LINNNDINLLDLPFVQSVPEIKLILQQLVKYSKKYTTSEQDDQSATINRR
QTPLQSNA

General negative regulator of transcription subunit 1 (Saccharomyces cerevisiae) is product of expression of CDC39 gene.

References:

Title Authors Journal Publication date (Issue) PubMed ID
NOT1(CDC39), NOT2(CDC36), NOT3, and NOT4 encode a global-negative regulator of transcription that differentially affects TATA-element utilization. Collart MA, Struhl K Genes Dev 1994-03-01 (8) 7926748
Ccr4p is the catalytic subunit of a Ccr4p/Pop2p/Notp mRNA deadenylase complex in Saccharomyces cerevisiae. Tucker M, Staples RR, Valencia-Sanchez MA, Muhlrad D, Parker R EMBO J 2002-03-15 (21) 11889048
Purification and characterization of the 1.0 MDa CCR4-NOT complex identifies two novel components of the complex. Chen J, Rappsilber J, Chiang YC, Russell P, Mann M, Denis CL J Mol Biol 2001-12-07 (314) 11733989
The complete DNA sequence of yeast chromosome III. Oliver SG, van der Aart QJ, Agostoni-Carbone ML, Aigle M, Alberghina L, Alexandraki D, Antoine G, Anwar R, Ballesta JP, Benit P, et al. Nature 1992-05-07 (357) 1574125
Global analysis of protein expression in yeast. Ghaemmaghami S, Huh WK, Bower K, Howson RW, Belle A, Dephoure N, O'Shea EK, Weissman JS Nature 2003-10-16 (425) 14562106
A multidimensional chromatography technology for in-depth phosphoproteome analysis. Albuquerque CP, Smolka MB, Payne SH, Bafna V, Eng J, Zhou H Mol Cell Proteomics 2008-07-01 (7) 18407956
Quantitative phosphoproteomics applied to the yeast pheromone signaling pathway. Gruhler A, Olsen JV, Mohammed S, Mortensen P, Faergeman NJ, Mann M, Jensen ON Mol Cell Proteomics 2005-03-01 (4) 15665377
Phosphoproteome analysis by mass spectrometry and its application to Saccharomyces cerevisiae. Ficarro SB, McCleland ML, Stukenberg PT, Burke DJ, Ross MM, Shabanowitz J, Hunt DF, White FM Nat Biotechnol 2002-03-01 (20) 11875433
The NOT proteins are part of the CCR4 transcriptional complex and affect gene expression both positively and negatively. Liu HY, Badarinarayana V, Audino DC, Rappsilber J, Mann M, Denis CL EMBO J 1998-01-16 (17) 9463387
The CCR4 and CAF1 proteins of the CCR4-NOT complex are physically and functionally separated from NOT2, NOT4, and NOT5. Bai Y, Salvadore C, Chiang YC, Collart MA, Liu HY, Denis CL Mol Cell Biol 1999-10-01 (19) 10490603
CDC39, an essential nuclear protein that negatively regulates transcription and differentially affects the constitutive and inducible HIS3 promoters. Collart MA, Struhl K EMBO J 1993-02-01 (12) 8428577



Add your own comment!


There are no comments yet.

Last modification of this entry: 2010-04-12 22:40:55
Edited by a user: kaja
Edited content: Changed species.

Welcome stranger! Click here to login or here to register.