Welcome! Click here to login or here to register.
Home
Pathways
Proteins
Catalytic RNA molecules
Enzymatic complexes
Structures
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

Exoribonuclease II, mitochondrial

 
Known also as: Deletion of SUV3 suppressor 1, Mitochondrial biogenesis protein MSU1

Known abbreviations: DSS1, MSU1, YMR287C, YM8021.13C

FUNCTION:

  • one of the two subunics of mitochondrial degradosome with 3'-5' exoribonuclease activity (the second one is ATP-dependent RNA helicase - Suv3p) (PMID: 12426313)
  • required for exoribonuclease activity of the degradosome which is essential for mitochondrial biogenesis (PMID: 12426313)
  • required for degradation of aberrant and unprocessed RNAs (as a part of degradosome) (PMID: 12426313)

CELLULAR LOCALIZATION:

mitochondrion (PMID: 12426313)

DOMAIN ARCHITECTURE:

Protein length: 969 aa (UniProt)
RNB_domain: 522-854 (InterPro)

SUBUNIT STRUCTURE:

MSU1 and SUV3 are the two components of the mitochondrial degradosome (mtEXO).



NCBI GI number(s): 6323943
296147408
Species: Saccharomyces cerevisiae

Links to other databases:

Database ID Link
Uniprot P39112 P39112
BRENDA - -
KEGG sce:YMR287C sce:YMR287C
PFAM: PF00773
PF00773
InterPro: IPR001900
IPR022966.
IPR001900
IPR022966.
CATH: - -
SCOP: - -


Protein sequence:
MVVRRKVHVLLIARSFHSYTPCFRVTTRGKRQRSKSKQQAKVELDHTREL
DNDQATETVVDRSVGPEKDIESINKDFLQRTKGLEPDIELKQLPQIKQEF
NQRYKDRYVKPSEDWYVNSWRSLTKPKIPLYKLINSDFQLITKLKAPNPM
EFQPVQLMESPLNVGDFVLLKMRPNELAMCVSLPSSTMDPRYTFVTIDGT
MCFATKNRVLLRIPHKLPAGIHSLIQPESHHKHLPIGTVKNFSNQTNILP
IVARQLITSRYPAQISKLAWKDLPITTKKLQLLHRSLQNYMGPWQIPFFT
LVGLVQKLDLNKALDDKNGINYLTSLVNNYHTVNDIPINSPTFVSTYWAI
MQQQESNLWGEIHLNTALLSPISVTIIPLKSQHLYYAQVIEKLEANSYRE
VNKFVKLVNERKYRDISALYPSVIQLLKDFAAGNFHNNGIIVALISKIFR
KIERYKDCDITRDICQDLINEITPNSIPNPLLLNMDLALPASSKLVKWQQ
KLYDLTNIEELQWKKSGTDDDRYDFGDLRVFCIDSETAHEIDDGVSVKNY
GRDGLYTLYIHIADPTSMFPESTNVDIEGISTDILNVALKRSFTTYLPDT
VVPMLPQSICHLSDLGKQGQRTKTISFSVDVKITSKCSGKSIEIMYDSFK
IRKGIVSNFPKATYEDVDRILGTPNSEASPVKKDLESLSMISKLLREQRI
KNSNAVIFGEGFNKGLVMLNADSEGELTEVTFSDQEETLSTILVSEMMIL
ANTLTGRYFAENKIGGVFRCYKQLPLGEVAQQQYDSMITSTKKGIFPKLK
DIVKLSSLLNSSFYTGRPFRHEMIGAKQYLTVTSPLRRFPDLINHLQIHR
HLQKKPLCFNQTQIDSLIWPIQSRADILKRASRNSSTYWTLNYLKKLTKL
EPERTFDVMVTSVPQNGFTGCVFPDLSFARGTLKLHPSSMHYPMIGDIVK
NCKISKIDCLEGMLELEKL

Exoribonuclease II, mitochondrial (Saccharomyces cerevisiae) is product of expression of DSS1 gene.

Exoribonuclease II, mitochondrial (Saccharomyces cerevisiae) belongs to following protein families:
References:

Title Authors Journal Publication date (Issue) PubMed ID
The yeast mitochondrial degradosome. Its composition, interplay between RNA helicase and RNase activities and the role in mitochondrial RNA metabolism. Dziembowski A, Piwowarski J, Hoser R, Minczuk M, Dmochowska A, Siep M, van der Spek H, Grivell L, Stepien PP J Biol Chem 2003-02-17 (278) 12426313
The nucleotide sequence of Saccharomyces cerevisiae chromosome XIII. Bowman S, Churcher C, Badcock K, Brown D, Chillingworth T, Connor R, Dedman K, Devlin K, Gentles S, Hamlin N, Hunt S, Jagels K, Lye G, Moule S, Odell C, Pearson D, Rajandream M, Rice P, Skelton J, Walsh S, Whitehead S, Barrell B Nature 1997-05-01 (387) 9169872
Global analysis of protein expression in yeast. Ghaemmaghami S, Huh WK, Bower K, Howson RW, Belle A, Dephoure N, O'Shea EK, Weissman JS Nature 2003-10-16 (425) 14562106
The novel nuclear gene DSS-1 of Saccharomyces cerevisiae is necessary for mitochondrial biogenesis. Dmochowska A, Golik P, Stepien PP Curr Genet 1995-07-01 (28) 8590460
Cloning and analysis of the nuclear gene for YmL33, a protein of the large subunit of the mitochondrial ribosome in Saccharomyces cerevisiae. Kang W, Matsushita Y, Grohmann L, Graack HR, Kitakawa M, Isono K J Bacteriol 1991-07-01 (173) 2061283
The yeast nuclear gene DSS1, which codes for a putative RNase II, is necessary for the function of the mitochondrial degradosome in processing and turnover of RNA. Dziembowski A, Malewicz M, Minczuk M, Golik P, Dmochowska A, Stepien PP Mol Gen Genet 1998-10-01 (260) 9829834
The proteome of Saccharomyces cerevisiae mitochondria. Sickmann A, Reinders J, Wagner Y, Joppich C, Zahedi R, Meyer HE, Schonfisch B, Perschil I, Chacinska A, Guiard B, Rehling P, Pfanner N, Meisinger C Proc Natl Acad Sci U S A 2003-11-11 (100) 14576278



Add your own comment!


There are no comments yet.

Last modification of this entry: Sept. 25, 2012.

Welcome stranger! Click here to login or here to register.