Welcome! Click here to login or here to register.
Home
Pathways
Proteins
Catalytic RNA molecules
Enzymatic complexes
Structures
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

Oligoribonuclease, mitochondrial

 
Known abbreviations: REX2, YNT20, YLR059C, L2159, ORN

FUNCTION:

  • Required for U4 snRNA 3' end trimming (PMID: 10716935)
  • 5.8 rRNA 3' end maturation (redundantly function) (PMID: 10716935)
  • U5 snRNA 3' end processing (redundantly function) (PMID: 10716935)
  • RNase P RNA processing (redundantly function) (PMID: 10716935)
  • Suppressor of yme1-mediated escape of DNA from the mitochondrion (PMID: 10716935)
  • Involved in spliceosom assembly by association with the snRNA PRP11 (PMID: 15892892)
  • involved in DNA repair by association with Rad50p (PMID: 15892892)

CELLULAR LOCALIZATION:

mitochondrion (PMID: 10716935)



Activities in which Oligoribonuclease, mitochondrial is involved: Pathways in which Oligoribonuclease, mitochondrial is involved:

NCBI GI number(s): 6323088
296146597
Species: Saccharomyces cerevisiae

Links to other databases:

Database ID Link
Uniprot P54964 P54964
BRENDA - -
KEGG sce:YLR059C sce:YLR059C
PFAM: PF00929
PF00929
InterPro: IPR006055
IPR013520
IPR012337
IPR006055
IPR013520
IPR012337
CATH: - -
SCOP: - -


Protein sequence:
MKWLLFPARIVARTRPNLFSLYRRSVSQYLRPRTIQNLQSMAQTPELKTK
LFKPLVWIDCEMTGLDHVNDRIIEICCIITDGHLAPVKAADGQGDSHYES
VIHYGPEVMNKMNEWCIEHHGNSGLTAKVLASEKTLAQVEDELLEYIQRY
IPDKNVGVLAGNSVHMDRLFMVREFPKVIDHLFYRIVDVSSIMEVARRHN
PALQARNPKKEAAHTAYSDIKESIAQLQWYMDNYLKPPQETESVESIGSE
QPESPSSSTSSLKRQRTDF

Oligoribonuclease, mitochondrial (Saccharomyces cerevisiae) is product of expression of REX2 gene.

Oligoribonuclease, mitochondrial (Saccharomyces cerevisiae) belongs to following protein families:
References:

Title Authors Journal Publication date (Issue) PubMed ID
Characterization of TRZ1, a yeast homolog of the human candidate prostate cancer susceptibility gene ELAC2 encoding tRNase Z. Chen Y, Beck A, Davenport C, Chen Y, Shattuck D, Tavtigian SV BMC Mol Biol 2005-01-01 (6) 15892892
Three conserved members of the RNase D family have unique and overlapping functions in the processing of 5S, 5.8S, U4, U5, RNase MRP and RNase P RNAs in yeast. van Hoof A, Lennertz P, Parker R EMBO J 2000-03-15 (19) 10716935
The nucleotide sequence of Saccharomyces cerevisiae chromosome XII. Johnston M, Hillier L, Riles L, Albermann K, Andre B, Ansorge W, Benes V, Bruckner M, Delius H, Dubois E, Dusterhoft A, Entian KD, Floeth M, Goffeau A, Hebling U, Heumann K, Heuss-Neitzel D, Hilbert H, Hilger F, Kleine K, Kotter P, Louis EJ, Messenguy F, Mewes HW, Hoheisel JD, et al. Nature 1997-05-01 (387) 9169871
Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae. Hu Y, Rolfs A, Bhullar B, Murthy TV, Zhu C, Berger MF, Camargo AA, Kelley F, McCarron S, Jepson D, Richardson A, Raphael J, Moreira D, Taycher E, Zuo D, Mohr S, Kane MF, Williamson J, Simpson A, Bulyk ML, Harlow E, Marsischky G, Kolodner RD, LaBaer J Genome Res 2007-04-01 (17) 17322287
Global analysis of protein expression in yeast. Ghaemmaghami S, Huh WK, Bower K, Howson RW, Belle A, Dephoure N, O'Shea EK, Weissman JS Nature 2003-10-16 (425) 14562106
YNT20, a bypass suppressor of yme1 yme2, encodes a putative 3'-5' exonuclease localized in mitochondria of Saccharomyces cerevisiae. Hanekamp T, Thorsness PE Curr Genet 1999-02-01 (34) 9933355



Add your own comment!


There are no comments yet.

Last modification of this entry: 2012-11-23 11:43:10
Edited by a user: kaja
Edited content: Changed abbreviations.

Welcome stranger! Click here to login or here to register.