Welcome! Click here to login or here to register.
Home
Pathways
Proteins
Catalytic RNA molecules
Enzymatic complexes
Structures
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

Exosome complex component RRP4

 
Known also as: Ribosomal RNA-processing protein 4

Known abbreviations: RRP4, YHR069C

FUNCTION:

  • exosome component without exonuclease activity - binding to the exosome ring on the RNase PH side (expected interaction between Rrp4p proteins Rrp6p and Rrp44p) (PMID: 17391830)
  • Required for  degradation of  3'-end of the 7S pre-RNA to generate mature 5.8S (S) rRNA and 5.8S(L) rRNA (cleavage at site C2 in 3'-5' direction) 
  • Processing occures in two steps:
    • initial rapid 3' -> 5' exonuclease processing yields a metastable product with a short 3' extension,
    •  removed first step's product by a slower trimming activity to yield the mature 5.8S rRNA. (PMID:9390555, 8600032, 9463390)
  • Required for degradation of 5' end of the 35S pre-rRNA in 3'-5' direction (cleavage at site A0) (PMID: 9463390,  10465791)
  • RNA-binding protein (PMID: 17942686)
  • degradation of deadenylated mRNA in 3'-5' direction  (PMID: 9482746)
CELLULAR LOCALIZATION:
  • nucleus (PMID: 10611222, 10465791)
  • cytoplasm (PMID: 10611222, 10465791)
DOMAIN ARCHITECTURE:
 
Protein length: 359 aa(UniProt)
S1: 107 - 187  (InterPro)
 
SUBUNIT STRUCTURE:
 
Component of the RNA exosome complex. Specifically part of the catalytically inactive RNA exosome core (Exo-9) complex which associates with catalytic subunits DIS3 and RRP6 in cytoplasmic- and nuclear-specific RNA exosome complex forms. Exo-9 is formed by a hexameric ring of RNase PH domain-containing subunits and peripheral S1 domain-containing components CSL4, RRP4 and RRP40 located on the top of the ring structure. Interacts with LRP1/RRP47.

 




This protein can be a part of a given complexes:
NCBI GI number(s): 6321860
296145446
Species: Saccharomyces cerevisiae

Links to other databases:

Database ID Link
Uniprot P38792 P38792
BRENDA - -
KEGG sce:YHR069C sce:YHR069C
PFAM: - P38792 (Link - using uniprot id)
InterPro: IPR022967
IPR022967
CATH: - -
SCOP: - -


Protein sequence:
MSEVITITKRNGAFQNSSNLSYNNTGISDDENDEEDIYMHDVNSASKSES
DSQIVTPGELVTDDPIWMRGHGTYFLDNMTYSSVAGTVSRVNRLLSVIPL
KGRYAPETGDHVVGRIAEVGNKRWKVDIGGKQHAVLMLGSVNLPGGILRR
KSESDELQMRSFLKEGDLLNAEVQSLFQDGSASLHTRSLKYGKLRNGMFC
QVPSSLIVRAKNHTHNLPGNITVVLGVNGYIWLRKTSQMDLARDTPSANN
SSSIKSTGPTGAVSLNPSITRLEEESSWQIYSDENDPSISNNIRQAICRY
ANVIKALAFCEIGITQQRIVSAYEASMVYSNVGELIEKNVMESIGSDILT
AEKMRGNGN

Exosome complex component RRP4 (Saccharomyces cerevisiae) is product of expression of RRP4 gene.

References:

Title Authors Journal Publication date (Issue) PubMed ID
Reconstitution, activities, and structure of the eukaryotic RNA exosome. Liu Q, Greimann JC, Lima CD Cell 2006-12-15 (127) 17174896
Global analysis of protein localization in budding yeast. Huh WK, Falvo JV, Gerke LC, Carroll AS, Howson RW, Weissman JS, O'Shea EK Nature 2003-10-16 (425) 14562095
The exosome: a conserved eukaryotic RNA processing complex containing multiple 3'-->5' exoribonucleases. Mitchell P, Petfalski E, Shevchenko A, Mann M, Tollervey D Cell 1997-11-14 (91) 9390555
Dob1p (Mtr4p) is a putative ATP-dependent RNA helicase required for the 3' end formation of 5.8S rRNA in Saccharomyces cerevisiae. de la Cruz J, Kressler D, Tollervey D, Linder P EMBO J 1998-01-16 (17) 9463390
The yeast exosome and human PM-Scl are related complexes of 3' --> 5' exonucleases. Allmang C, Petfalski E, Podtelejnikov A, Mann M, Tollervey D, Mitchell P Genes Dev 1999-08-15 (13) 10465791
Yeast exosome mutants accumulate 3'-extended polyadenylated forms of U4 small nuclear RNA and small nucleolar RNAs. van Hoof A, Lennertz P, Parker R Mol Cell Biol 2000-02-01 (20) 10611222
Architecture of the yeast Rrp44 exosome complex suggests routes of RNA recruitment for 3' end processing. Wang HW, Wang J, Ding F, Callahan K, Bratkowski MA, Butler JS, Nogales E, Ke A Proc Natl Acad Sci U S A 2007-10-23 (104) 17942686
The exosome contains domains with specific endoribonuclease, exoribonuclease and cytoplasmic mRNA decay activities. Schaeffer D, Tsanova B, Barbas A, Reis FP, Dastidar EG, Sanchez-Rotunno M, Arraiano CM, van Hoof A Nat Struct Mol Biol 2009-02-01 (16) 19060898
The 3' end of yeast 5.8S rRNA is generated by an exonuclease processing mechanism. Mitchell P, Petfalski E, Tollervey D Genes Dev 1996-01-15 (10) 8600032
The 3' to 5' degradation of yeast mRNAs is a general mechanism for mRNA turnover that requires the SKI2 DEVH box protein and 3' to 5' exonucleases of the exosome complex. Anderson JS, Parker RP EMBO J 1998-03-02 (17) 9482746
Complete nucleotide sequence of Saccharomyces cerevisiae chromosome VIII. Johnston M, Andrews S, Brinkman R, Cooper J, Ding H, Dover J, Du Z, Favello A, Fulton L, Gattung S, et al. Science 1994-09-01 (265) 8091229
A single subunit, Dis3, is essentially responsible for yeast exosome core activity. Dziembowski A, Lorentzen E, Conti E, Seraphin B Nat Struct Mol Biol 2007-02-01 (14) 17173052
Global analysis of protein expression in yeast. Ghaemmaghami S, Huh WK, Bower K, Howson RW, Belle A, Dephoure N, O'Shea EK, Weissman JS Nature 2003-10-16 (425) 14562106
A multidimensional chromatography technology for in-depth phosphoproteome analysis. Albuquerque CP, Smolka MB, Payne SH, Bafna V, Eng J, Zhou H Mol Cell Proteomics 2008-07-01 (7) 18407956
Rrp47p is an exosome-associated protein required for the 3' processing of stable RNAs. Mitchell P, Petfalski E, Houalla R, Podtelejnikov A, Mann M, Tollervey D Mol Cell Biol 2003-10-01 (23) 12972615



Add your own comment!


There are no comments yet.

Last modification of this entry: Sept. 25, 2012.

Welcome stranger! Click here to login or here to register.