Welcome! Click here to login or here to register.
Home
Pathways
Proteins
Catalytic RNA molecules
Enzymatic complexes
Structures
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

Exosome complex component RRP40

 
Known also as: Ribosomal RNA-processing protein 40

Known abbreviations: RRP40, YOL142W

FUNCTION:

  • exosome component without catalytic activity: expected interaction with Rrp43p and Rrp45p (PMID: 17391830, 17942686) 
  • RNA-binding protein (PMID: 17942686, 17391830, 17159918)
  • presence of a manganese-binding site at the interface of the two domains (the Mn2+ could have structural role and/or enhance RNA binding in the full exosome) (PMID: 17391830, 17159918)
CELLULAR LOCALIZATION:
 
CytoplasmNucleus › nucleolus.
 
SUBUNIT STRUCTURE:
 
Component of the RNA exosome complex. Specifically part of the catalytically inactive RNA exosome core (Exo-9) complex which associates with catalytic subunits DIS3 and RRP6 in cytoplasmic- and nuclear-specific RNA exosome complex forms. Exo-9 is formed by a hexameric ring of RNase PH domain-containing subunits and peripheral S1 domain-containing components CSL4, RRP4 and RRP40 located on the top of the ring structure.
 
OTHER:
  • includes regions homologous  to the S1 RNA-binding domain from E.coli (PMID: 10465791) and KH domain (PMID: 17159918)
  • Rrp40p has no corresponding subunits in archaea(PMID: 17159918)



This protein can be a part of a given complexes:
NCBI GI number(s): -
Species: Saccharomyces cerevisiae

Links to other databases:

Database ID Link
Uniprot Q08285 Q08285
BRENDA - -
KEGG sce:YOL142W sce:YOL142W
PFAM: - Q08285 (Link - using uniprot id)
InterPro: - Q08285 (Link - using uniprot id)
CATH: - -
SCOP: - -
Solved crystal structures: 2JA9
[PDB] [details]


Protein sequence:
MSTFIFPGDSFPVDPTTPVKLGPGIYCDPNTQEIRPVNTGVLHVSAKGKS
GVQTAYIDYSSKRYIPSVNDFVIGVIIGTFSDSYKVSLQNFSSSVSLSYM
AFPNASKKNRPTLQVGDLVYARVCTAEKELEAEIECFDSTTGRDAGFGIL
EDGMIIDVNLNFARQLLFNNDFPLLKVLAAHTKFEVAIGLNGKIWVKCEE
LSNTLACYRTIMECCQKNDTAAFKDIAKRQFKEILTVKEE

Exosome complex component RRP40 (Saccharomyces cerevisiae) is product of expression of RRP40 gene.

References:

Title Authors Journal Publication date (Issue) PubMed ID
Reconstitution, activities, and structure of the eukaryotic RNA exosome. Liu Q, Greimann JC, Lima CD Cell 2006-12-15 (127) 17174896
Global analysis of protein localization in budding yeast. Huh WK, Falvo JV, Gerke LC, Carroll AS, Howson RW, Weissman JS, O'Shea EK Nature 2003-10-16 (425) 14562095
The yeast exosome and human PM-Scl are related complexes of 3' --> 5' exonucleases. Allmang C, Petfalski E, Podtelejnikov A, Mann M, Tollervey D, Mitchell P Genes Dev 1999-08-15 (13) 10465791
Architecture of the yeast Rrp44 exosome complex suggests routes of RNA recruitment for 3' end processing. Wang HW, Wang J, Ding F, Callahan K, Bratkowski MA, Butler JS, Nogales E, Ke A Proc Natl Acad Sci U S A 2007-10-23 (104) 17942686
The exosome contains domains with specific endoribonuclease, exoribonuclease and cytoplasmic mRNA decay activities. Schaeffer D, Tsanova B, Barbas A, Reis FP, Dastidar EG, Sanchez-Rotunno M, Arraiano CM, van Hoof A Nat Struct Mol Biol 2009-02-01 (16) 19060898
Analysis of the Saccharomyces cerevisiae exosome architecture and of the RNA binding activity of Rrp40p. Luz JS, Tavares JR, Gonzales FA, Santos MC, Oliveira CC Biochimie 2007-05-01 (89) 17391830
Structural and biochemical characterization of the yeast exosome component Rrp40. Oddone A, Lorentzen E, Basquin J, Gasch A, Rybin V, Conti E, Sattler M EMBO Rep 2007-02-01 (8) 17159918
The nucleotide sequence of Saccharomyces cerevisiae chromosome XV. Dujon B, Albermann K, Aldea M, Alexandraki D, Ansorge W, Arino J, Benes V, Bohn C, Bolotin-Fukuhara M, Bordonne R, Boyer J, Camasses A, Casamayor A, Casas C, Cheret G, Cziepluch C, Daignan-Fornier B, Dang DV, de Haan M, Delius H, Durand P, Fairhead C, Feldmann H, Gaillon L, Kleine K, et al. Nature 1997-05-01 (387) 9169874
A single subunit, Dis3, is essentially responsible for yeast exosome core activity. Dziembowski A, Lorentzen E, Conti E, Seraphin B Nat Struct Mol Biol 2007-02-01 (14) 17173052
Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae. Hu Y, Rolfs A, Bhullar B, Murthy TV, Zhu C, Berger MF, Camargo AA, Kelley F, McCarron S, Jepson D, Richardson A, Raphael J, Moreira D, Taycher E, Zuo D, Mohr S, Kane MF, Williamson J, Simpson A, Bulyk ML, Harlow E, Marsischky G, Kolodner RD, LaBaer J Genome Res 2007-04-01 (17) 17322287
Global analysis of protein expression in yeast. Ghaemmaghami S, Huh WK, Bower K, Howson RW, Belle A, Dephoure N, O'Shea EK, Weissman JS Nature 2003-10-16 (425) 14562106
A multidimensional chromatography technology for in-depth phosphoproteome analysis. Albuquerque CP, Smolka MB, Payne SH, Bafna V, Eng J, Zhou H Mol Cell Proteomics 2008-07-01 (7) 18407956



Add your own comment!


There are no comments yet.

Last modification of this entry: 2012-11-23 09:56:27
Edited by a user: kaja
Edited content: Changed kegg and gene.

Welcome stranger! Click here to login or here to register.