ID Card:

Full name: tRNA-specific adenosine deaminase subunit TAD2
UniProt: V5DKK8
Complex: Tad2/3
Enzyme type:
Position of modification - modification: t:None - I
Level of experimental evidence: 5
Level of experimental reliability: 5



Protein sequence:

MGEGINDDKVVYCDAFMLAAFAEARAALAEGEVPVGCVLVPAEASCPANAGRLDDNNPNNSGASLGNLIAARGRNATNKEHHALAHAEFVAVEALLRDAAEKGRKPPASLAGYVLYVVVEPCIMCAAMLLYNRIKKVYFGCGNPRFGGNGTVLAVHAAKSTSAPAYESCGGHRAEEAITLLQEFYSRENSAAPDHKRRRKDI

Comments:

T. cruzi ADAT2 and ADAT3 proteins form a catalytically active heterodimer similar to eukaryotic ADATs. This enzyme complex catalyzes the essential adenosine-to-inosine (A34-to-I) editing in the wobble position (position 34) of certain tRNAs,




Reaction Substrate SubstrateType Position (Anti)Codon Modified (Anti)Codon Amino Acid Change Transcript Name Transcript Region Cellular Localization References
A:I tRNA (t) tRNA/tRNA/eukaryotic cytosol 34



Publications:

Title Authors Journal Details PubMed Id DOI
Characterization of ADAT2/3 molecules in Trypanosoma cruzi and regulation of mucin gene expression by tRNA editing. Bertotti S; Fleming I; Cámara MLM; Centeno Cameán C; Carmona SJ; Agüero F; Balouz V; Zahn A; Di Noia JM; Alfonzo JD; Buscaglia CA Biochem J [details] 35136964 10.1042/BCJ20210850